Wikipedia:Historical archive/Logs/Deletion log/October 2002: Difference between revisions
Appearance
Content deleted Content added
mNo edit summary |
m Scott moved page Wikipedia:Deletion log/October 2002 to Wikipedia:Historical archive/Logs/Deletion log/October 2002 |
||
(8 intermediate revisions by 5 users not shown) | |||
Line 1: | Line 1: | ||
__NOINDEX__ |
|||
==[[Wikipedia:Deletion log]] Archive for October 2002== |
==[[Wikipedia:Deletion log]] Archive for October 2002 (936 deletions) == |
||
⚫ | |||
#22:08 Oct 31, 2002 [[User:Maveric149|Maveric149]] deleted "Computer keyboard" <em>(just a redirect page -- need to get this out of the way for a move)</em> |
|||
< |
#20:47 Oct 31, 2002 [[User:Tarquin|Tarquin]] deleted "Solar tower" <em>(no content)</em> |
||
#15:55 Oct 31, 2002 [[User:Jheijmans|Jheijmans]] deleted "Modern Pentathlon at the 1936 Summer Olympics" <em>(\"Which male won the 100 and 200 meter gold medals?\")</em> |
|||
#09:43 Oct 31, 2002 [[User:Magnus Manske|Magnus Manske]] deleted "Saint-Cyr" <em>(Says \"Cyr = Cyriacus Quiriacus = Quiricus\")</em> |
|||
#08:46 Oct 31, 2002 [[User:Magnus Manske|Magnus Manske]] deleted "Data storage" <em>(newbie experiment)</em> |
|||
#08:11 Oct 31, 2002 [[User:Jheijmans|Jheijmans]] deleted "Liar (short story)" <em>(what)</em> |
|||
#08:11 Oct 31, 2002 [[User:Jheijmans|Jheijmans]] deleted "Sumerian Early Dynastic period" <em>(you all suck)</em> |
|||
#08:10 Oct 31, 2002 [[User:Jheijmans|Jheijmans]] deleted "Analog first generation" <em>(Put your text for the new page here. FHFHFHFH)</em> |
|||
#08:10 Oct 31, 2002 [[User:Jheijmans|Jheijmans]] deleted "Automaton" <em>(hello how are u)</em> |
|||
#08:10 Oct 31, 2002 [[User:Jheijmans|Jheijmans]] deleted "State diagram" <em>(abUababa)</em> |
|||
#08:10 Oct 31, 2002 [[User:Jheijmans|Jheijmans]] deleted "Talk:2209" <em>(talk of delete dpage)</em> |
|||
#08:10 Oct 31, 2002 [[User:Jheijmans|Jheijmans]] deleted "2209" <em>(\"hola nietos , espero q esten q esten bien , y el sida no sea problema , fernando lopina buenos aires octubre del 2002\")</em> |
|||
#08:09 Oct 31, 2002 [[User:Jheijmans|Jheijmans]] deleted "Turing reduction" <em>(\"Wikipedia (n): 1) Wikipedia derives its meaning from the Greek words \"Wiki\", meaning \"The\", and \"pedia\" meaning \"Free Encyclopedia.\" How these two unrelated words were combined into \"Wikipedia\" remains lost in the annals of time.\")</em> |
|||
#08:09 Oct 31, 2002 [[User:Jheijmans|Jheijmans]] deleted "Kitakyushu" <em>(\"Put your text for the new page here. \'\")</em> |
|||
#08:08 Oct 31, 2002 [[User:Jheijmans|Jheijmans]] deleted "Fraser River" <em>(\"Put your text for the new page here. this web site sux a$$\")</em> |
|||
#08:08 Oct 31, 2002 [[User:Jheijmans|Jheijmans]] deleted "La Cliqua" <em>(\"Put your text for the new page here. Hello all. I need some good music for my really boring French2 class. My teacher said we could get something a little more \"hip. Get me some sik beats! Merci. Musique fableaux! Tres chic et neveau.\")</em> |
|||
#08:07 Oct 31, 2002 [[User:Jheijmans|Jheijmans]] deleted "Ad hoc protocol list" <em>(\"Some of the existing protocols:\")</em> |
|||
#07:37 Oct 31, 2002 [[User:JeLuF|JeLuF]] deleted "Sir Andrew Ramsay" <em>(Content: \"he was cool\", 172.164.123.242)</em> |
|||
#07:37 Oct 31, 2002 [[User:JeLuF|JeLuF]] deleted "Synonymy" <em>(Content: \"abdi jumped the window\", 137.111.13.32)</em> |
|||
#06:48 Oct 31, 2002 [[User:Sjc|Sjc]] deleted "Peter Tosh" <em>(This page is unsavable when edited. Bug report submitted.)</em> |
|||
#05:32 Oct 31, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Christian Dior" <em>(Garbage by 64.166.108.167; only text \"fucking loser\")</em> |
|||
#05:22 Oct 31, 2002 [[User:Maveric149|Maveric149]] deleted "Rhenium/Temp" <em>(temp page that is no longer needed)</em> |
|||
#03:36 Oct 31, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Richard Leakey" <em>(newbie experiment by 208.224.150.138: \"he is cool\")</em> |
|||
#23:58 Oct 30, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Charles's law" <em>(low-entropy junk by 152.163.188.2: \"AAAAAAA\"...)</em> |
|||
#22:55 Oct 30, 2002 [[User:The Epopt|The Epopt]] deleted "Agosta 90B class submarine" <em>(deletion of redirect to allow move)</em> |
|||
#20:36 Oct 30, 2002 [[User:JeLuF|JeLuF]] deleted "Olde Cheshire Cheese (London pub)" <em>(Content: \"Metta il vostro testo per la nuova pagina qui.prpducco formaggio staggionato con pezzi di vemi,è un formaggio a base di latte del toro \", 80.206.239.230)</em> |
|||
#20:35 Oct 30, 2002 [[User:JeLuF|JeLuF]] deleted "Top-down" <em>(Content: \"Put your text for the new page here. gfsgs\", 128.211.249.253)</em> |
|||
#20:34 Oct 30, 2002 [[User:JeLuF|JeLuF]] deleted "Nearest neighbor algorithm" <em>(Content: some hundred random characters, 211.72.158.234)</em> |
|||
#20:33 Oct 30, 2002 [[User:JeLuF|JeLuF]] deleted "Dog whistle" <em>(Content: \"sfsfsdgggs\", 142.22.16.54)</em> |
|||
#20:32 Oct 30, 2002 [[User:JeLuF|JeLuF]] deleted "Sforzando" <em>(Content: \"Put your text for the new page here. yeah, whatever \", 208.32.128.10)</em> |
|||
#18:57 Oct 30, 2002 [[User:Tarquin|Tarquin]] deleted "BLT sandwitch" <em>(mispeeling)</em> |
|||
#18:56 Oct 30, 2002 [[User:Tarquin|Tarquin]] deleted "BLT sandwich" <em>(making way)</em> |
|||
#18:54 Oct 30, 2002 [[User:Tarquin|Tarquin]] deleted "Club sandwich" <em>(no content)</em> |
|||
#15:51 Oct 30, 2002 [[User:Tarquin|Tarquin]] deleted "N'Djamena" <em>(212.219.189.245 -- go home)</em> |
|||
#15:50 Oct 30, 2002 [[User:Ed Poor|Ed Poor]] deleted "Renaming page, as suggested" <em>(completing move)</em> |
|||
#15:46 Oct 30, 2002 [[User:Tarquin|Tarquin]] deleted "WikiWiki)" <em>(daft title)</em> |
|||
#15:37 Oct 30, 2002 [[User:Magnus Manske|Magnus Manske]] deleted "WikiWiki)" <em>(newbie test)</em> |
|||
#12:52 Oct 30, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "CMOS Memory" <em>(Newbie experiment; \"Put your text for the new page here. are you kidding me?\")</em> |
|||
#12:14 Oct 30, 2002 [[User:Tarquin|Tarquin]] deleted "Nipple piercing" <em>(junk entry. Hey, it\'d be a junk entry no matter *what* people wrote here. Wikipedia does not encourage self-mutilation, blah blah)</em> |
|||
#10:50 Oct 30, 2002 [[User:Jheijmans|Jheijmans]] deleted "De Witt Clinton" <em>(empty, prev \"what? i don\'t want to edit, i want to read...this isn\'t helping me with m term paper...\")</em> |
|||
#10:50 Oct 30, 2002 [[User:Jheijmans|Jheijmans]] deleted "Preda Mihailescu" <em>(empty, prev \"Poos\")</em> |
|||
#10:50 Oct 30, 2002 [[User:Jheijmans|Jheijmans]] deleted "When it Happens" <em>(\"When It Happens, by Margaret Atwood\")</em> |
|||
#10:49 Oct 30, 2002 [[User:Jheijmans|Jheijmans]] deleted "Mossel Bay" <em>(empty, prev \"Put your text for the new page here. what exactly is Mossel Bay?\")</em> |
|||
#04:32 Oct 30, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Zu Chen" <em>(Garbage by 203.166.47.226; only content \"she is silly\")</em> |
|||
#04:32 Oct 30, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Jun Xie" <em>(Garbage by 203.166.47.226; only content \"she is dum\")</em> |
|||
#01:28 Oct 30, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Henri Désiré Landru" <em>(garbage by 64.12.96.102: \"u are abasshole\", since deleted)</em> |
|||
#23:10 Oct 29, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Mercury-in-glass thermometer" <em>(\"Put your text for the new page here.uufifki , t 9i 8rg ij trj ju j jrttjj j 5ju jt ujutjuijuf0 ij ijjjjjj i0 9i juj j ju ju j u8juj 90 ij 0j8 vuiujfhuyi j u8hfooj guity tryt rgrrg.\")</em> |
|||
#23:01 Oct 29, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Thylakoid" <em>(nonsense by 24.197.134.228: \"dskfudfsg\")</em> |
|||
#22:54 Oct 29, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Image:Vaag.JPG" <em>(Junk image. Some screen in Dutch showing the epoch as an erroneous time, circled.)</em> |
|||
#21:26 Oct 29, 2002 [[User:Jheijmans|Jheijmans]] deleted "Edit" <em>(empty, bullshit before)</em> |
|||
#21:26 Oct 29, 2002 [[User:Jheijmans|Jheijmans]] deleted "Tramping" <em>(\"New Zealand epxression for hiking.\")</em> |
|||
#20:20 Oct 29, 2002 [[User:JeLuF|JeLuF]] deleted "Lloyd Bentsen" <em>(Content: \"Put your text for the new page here. Lloyd I love You \")</em> |
|||
#19:21 Oct 29, 2002 [[User:Tarquin|Tarquin]] deleted "Harry Potter and the Order of the Phoenix" <em>(go home kids)</em> |
|||
#17:32 Oct 29, 2002 [[User:Ed Poor|Ed Poor]] deleted "Moscow theatre siege" <em>(make room for move)</em> |
|||
#13:59 Oct 29, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Hitler: The Last Ten Days" <em>(Garbage, no history; only content \"he had sex with his dog\". (156.63.205.5))</em> |
|||
#13:52 Oct 29, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Battle of Otford" <em>(Only content \"Put your text for the new page here. THE BATTLE OF OTFORD IS STILL ONGOING, I HAVE A BATTLE TO PARK MY CAR EVERY TIME I GO THERE\" - moved to Bad jokes and other deleted nonsense page)</em> |
|||
#13:31 Oct 29, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Talk:Hafez al-Assad" <em>(Garbage; only content \"he gave good head\")</em> |
|||
#13:30 Oct 29, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Image talk:Hitler.jpg" <em>(Garbage; only content \"he was a gay fucker\")</em> |
|||
#13:27 Oct 29, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Sukarno" <em>(Garbage; only content \'he liked getting fucked in the ass. He had a homosextual boyfriend named kyle rooney. they had sex all the time.\')</em> |
|||
#13:26 Oct 29, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Suharto" <em>(No history; only content \"eat my dick\")</em> |
|||
#11:26 Oct 29, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "X/Open" <em>(one sentence stub does not relate to the title)</em> |
|||
#10:00 Oct 29, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Peasant rebellion" <em>(empty orphaned list)</em> |
|||
#09:53 Oct 29, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "University of Birmingham" <em>(you may loooove the uni, but that\'s not an article)</em> |
|||
#09:51 Oct 29, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Dictionary of the Norwegian Dialects" <em>(hei)</em> |
|||
#09:14 Oct 29, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "St. Paul's Cathedral" <em>(No history; only content \"Pigs fly!!!\")</em> |
|||
#07:52 Oct 29, 2002 [[User:Jheijmans|Jheijmans]] deleted "Bob Kane" <em>(\"Co-creator of Batman.\")</em> |
|||
#07:13 Oct 29, 2002 [[User:JeLuF|JeLuF]] deleted "Pi-calculus" <em>(Content: \"Mostly harmless\")</em> |
|||
#07:13 Oct 29, 2002 [[User:JeLuF|JeLuF]] deleted "Dwarf elliptical galaxy" <em>(Content: \"This is a NEW PAGE -Do you like it????????????? \")</em> |
|||
#05:23 Oct 29, 2002 [[User:AxelBoldt|AxelBoldt]] deleted "Post system" <em>(the contents \"erttywedsfgsdfgertg \" did not quite match expectations)</em> |
|||
#04:21 Oct 29, 2002 [[User:Koyaanis Qatsi|Koyaanis Qatsi]] deleted "Image:Aalayout.jpg" <em>(some big (700 k card professing love for somebody, unused in any article))</em> |
|||
#03:27 Oct 29, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "0001 B.C." <em>(junk by 64.12.96.106. What\'s a \"poochi-wa\"?)</em> |
|||
#03:24 Oct 29, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Talk:Hydroelectricity" <em>(junk by 24.76.80.198: \"sup\")</em> |
|||
#03:23 Oct 29, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Archaism" <em>(mere def by 80.37.58.169: \"Use of an ancient word.\")</em> |
|||
#03:09 Oct 29, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Image:Marigoldthumbnail.pg.jpg" <em>(mistaken identity)</em> |
|||
#03:07 Oct 29, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Mechanical energy" <em>(vandalism)</em> |
|||
#03:06 Oct 29, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Breach of contract" <em>(Ask Professor Kinsfield.)</em> |
|||
#03:06 Oct 29, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Isolating language" <em>(things to be believed in)</em> |
|||
#03:05 Oct 29, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Gush Shalom" <em>(shalom)</em> |
|||
#03:05 Oct 29, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Push-down automaton" <em>(junk)</em> |
|||
#03:04 Oct 29, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Morrill act" <em>(om)</em> |
|||
#01:03 Oct 29, 2002 [[User:Tarquin|Tarquin]] deleted "OMW" <em>(junk entry)</em> |
|||
#19:43 Oct 28, 2002 [[User:JeLuF|JeLuF]] deleted "Free Software movement" <em>(Content: \"this is my test page for compressing a text file using Lempel ziv compressio algorithm \")</em> |
|||
⚫ | |||
this is my test page for compressing a text file using Lempel ziv compressio algorithm \")</em></li> |
|||
#18:22 Oct 28, 2002 [[User:Jheijmans|Jheijmans]] deleted "Application server" <em>(\"AHMED\")</em> |
|||
#15:56 Oct 28, 2002 [[User:Ed Poor|Ed Poor]] deleted "Unification Church and anti-Semitism" <em>(making room for a \"Move\")</em> |
|||
#15:49 Oct 28, 2002 [[User:Tarquin|Tarquin]] deleted "Cut in" <em>(junk entry)</em> |
|||
#14:12 Oct 28, 2002 [[User:Jheijmans|Jheijmans]] deleted "Rembrandt" <em>(needed for move - just a redirect)</em> |
|||
#12:51 Oct 28, 2002 [[User:Magnus Manske|Magnus Manske]] deleted "Asian crisis" <em>(Says \" test test2\")</em> |
|||
#08:10 Oct 28, 2002 [[User:Maveric149|Maveric149]] deleted "Nonviolence" <em>(See ahimsa. = not an article)</em> |
|||
#07:53 Oct 28, 2002 [[User:Jheijmans|Jheijmans]] deleted "Andorra la Vella" <em>(redirect, needed for a move)</em> |
|||
#06:51 Oct 28, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Mitochondrial membrane" <em>(I don\'t care if you want to learn more about cells - do your own research)</em> |
|||
#06:40 Oct 28, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Michigan Rummy" <em>(vandalism)</em> |
|||
#06:10 Oct 28, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "The war against Reform and Conservative Judaism" <em>(article moved to talk pending removal entirely)</em> |
|||
⚫ | |||
#05:50 Oct 28, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Demagoguery" <em>(\'what is demagoguery? A pejorative synonym for demagogy)</em> |
|||
⚫ | |||
#05:47 Oct 28, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Motor coil resistance" <em>(experiment)</em> |
|||
#05:40 Oct 28, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Hollywood Babylon" <em>(Holly Wood Babylon is a book. - until someone can be more specific we don\'t need this!)</em> |
|||
#05:40 Oct 28, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Tax evasion" <em>(i asked you weedo)</em> |
|||
#05:39 Oct 28, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Progenote" <em>(Wikipedia is not a dictionary: \"universal ancestor\")</em> |
|||
#05:39 Oct 28, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Progenote" <em>(universal ancestor )</em> |
|||
#05:38 Oct 28, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Tollund" <em>(several generations of garbage!)</em> |
|||
#05:37 Oct 28, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Meet in the middle" <em>(Hi I Am A Man.)</em> |
|||
#05:26 Oct 28, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Lock and key" <em>(nonsense by 65.95.156.177: \"Put your text for the new page here. ff fdskjt fkdst eif dfjfj dflkjdsfsdf\")</em> |
|||
#02:53 Oct 28, 2002 [[User:Maveric149|Maveric149]] deleted "Spindle" <em>(spindle )</em> |
|||
#02:24 Oct 28, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Talk:Mystery" <em>(the day for this self-advertisment is done... )</em> |
|||
#01:13 Oct 28, 2002 [[User:Isis|Isis]] deleted "Image:Tartan.PNG" <em>(we\'re done talking about it)</em> |
|||
#00:58 Oct 28, 2002 [[User:Maveric149|Maveric149]] deleted "Image:Tour group entering South Portal of Yucca Mountain.jpg" <em>(Wrong name)</em> |
|||
#00:58 Oct 28, 2002 [[User:Maveric149|Maveric149]] deleted "Image:Tour group entering South Portal of Yucca Mountain.jpg" <em>(It\'s the /North/ Portal)</em> |
|||
#22:58 Oct 27, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Colouring algorithm" <em>(nonsense by 131.238.116.232: \"Put your text for the new page here. sadasdasdasd\")</em> |
|||
#22:04 Oct 27, 2002 [[User:Jheijmans|Jheijmans]] deleted "Frederick II of Naples" <em>(empty, prev \"moo\")</em> |
|||
#21:10 Oct 27, 2002 [[User:Jheijmans|Jheijmans]] deleted "Shopping mall" <em>(\"Shopping center. The place/building where several stores are located. \")</em> |
|||
#20:20 Oct 27, 2002 [[User:Scipius|Scipius]] deleted "Estonia/Temp" <em>(Temp page no longer necessary)</em> |
|||
#19:45 Oct 27, 2002 [[User:JeLuF|JeLuF]] deleted "Black widow spider" <em>(Content: \"Fuck that shit \")</em> |
|||
#19:37 Oct 27, 2002 [[User:Maveric149|Maveric149]] deleted "Fort Garry" <em>(ddfkld\' )</em> |
|||
#17:17 Oct 27, 2002 [[User:JeLuF|JeLuF]] deleted "Fluorescent light" <em>(Content: \"Sup Dawgs \")</em> |
|||
#17:15 Oct 27, 2002 [[User:JeLuF|JeLuF]] deleted "Rollie Fingers" <em>(Content: \" Put your text for the new page here. he is a penis eater \")</em> |
|||
#17:13 Oct 27, 2002 [[User:JeLuF|JeLuF]] deleted "Dogrib" <em>(Content: \"The dogribs ate dog and wolf ribs! \")</em> |
|||
#17:06 Oct 27, 2002 [[User:JeLuF|JeLuF]] deleted "Page Widening" <em>(Content: \"Slashdot sucks! \")</em> |
|||
#14:28 Oct 27, 2002 [[User:Magnus Manske|Magnus Manske]] deleted "Image:Soldierwithwings thumb.htm" <em>(crap ;-))</em> |
|||
#12:31 Oct 27, 2002 [[User:Jheijmans|Jheijmans]] deleted "User:Jheijmans/Zandbak" <em>(some testing...)</em> |
|||
#12:03 Oct 27, 2002 [[User:Jheijmans|Jheijmans]] deleted "Quantum dot computer" <em>(\"Put your text for the new page here. dfd \")</em> |
|||
#12:02 Oct 27, 2002 [[User:Jheijmans|Jheijmans]] deleted "Joel David Bondurant" <em>(\"Famous mathematician and physicist. \")</em> |
|||
#12:01 Oct 27, 2002 [[User:Jheijmans|Jheijmans]] deleted "Kassubian" <em>(\"FUCK THE GODDAMN SLAVS!!! \")</em> |
|||
#08:34 Oct 27, 2002 [[User:JeLuF|JeLuF]] deleted "Goddess of Democracy" <em>(Content:\" <A href=\"http://www.google.com\">hi</A> \")</em> |
|||
#07:41 Oct 27, 2002 [[User:Maveric149|Maveric149]] deleted "John Wilkins" <em>(Put your text for the new page here. John Wilkins )</em> |
|||
#03:13 Oct 27, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Basidium" <em>(by 63.20.117.149 -- no history, only content \"u dont know shit do u? NNNNOOOOOO!!\")</em> |
|||
#03:09 Oct 27, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Espionage Act" <em>(Non-article; only content \"The Espionage Act sucked and so did Palmer! Did you know that people can have sex all day every 30 mins?\")</em> |
|||
#02:34 Oct 27, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Eurpoean" <em>(title is misspelled)</em> |
|||
#01:10 Oct 27, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Talk:Francesco Andreini" <em>(newbie experiment by 68.44.116.247: only content \"Hello\")</em> |
|||
#22:04 Oct 26, 2002 [[User:Maveric149|Maveric149]] deleted "User:194.117.133.196" <em>(Vandal page)</em> |
|||
#21:58 Oct 26, 2002 [[User:Maveric149|Maveric149]] deleted "Hilary rosen" <em>(result of vandalism)</em> |
|||
#21:57 Oct 26, 2002 [[User:Maveric149|Maveric149]] deleted "Excrement" <em>(result of vandalism)</em> |
|||
#21:57 Oct 26, 2002 [[User:Maveric149|Maveric149]] deleted "Contructophobia" <em>(stub. )</em> |
|||
#21:56 Oct 26, 2002 [[User:Maveric149|Maveric149]] deleted "0o0o0o0o0o0o0o0o0o0" <em>(result of vandalism)</em> |
|||
#21:55 Oct 26, 2002 [[User:Maveric149|Maveric149]] deleted "WikiWikiWikiWiki" <em>(result of vandalism)</em> |
|||
#21:05 Oct 26, 2002 [[User:Maveric149|Maveric149]] deleted "Greek Orthodox" <em>(ee also under \"Suzy Khimm\". )</em> |
|||
#20:01 Oct 26, 2002 [[User:Danny|Danny]] deleted "Hormizd II of Persai" <em>(typo in title)</em> |
|||
#18:56 Oct 26, 2002 [[User:Scipius|Scipius]] deleted "Jules Bonnot" <em>(Full text: \"sgh ahe \" (Edit Comment: ehhr))</em> |
|||
#15:17 Oct 26, 2002 [[User:Jheijmans|Jheijmans]] deleted "Zacharias Janssen" <em>(\"hi\")</em> |
|||
#15:16 Oct 26, 2002 [[User:Jheijmans|Jheijmans]] deleted "Krankenhaus" <em>(there\'s no need for redirects in German for normal English words)</em> |
|||
#15:15 Oct 26, 2002 [[User:Jheijmans|Jheijmans]] deleted "Mayan hieroglyph" <em>(\"karlisha ladawn monday \")</em> |
|||
#15:15 Oct 26, 2002 [[User:Jheijmans|Jheijmans]] deleted "MIPS architecture/Instructions" <em>(\"gjkhj \")</em> |
|||
#15:14 Oct 26, 2002 [[User:Jheijmans|Jheijmans]] deleted "PC-DOS" <em>(\"kij\")</em> |
|||
#14:15 Oct 26, 2002 [[User:Jheijmans|Jheijmans]] deleted "China/Temp" <em>(temporary page)</em> |
|||
#12:52 Oct 26, 2002 [[User:Jheijmans|Jheijmans]] deleted "Ancient Roman eschatology" <em>(empty, prev \"nice\")</em> |
|||
#12:52 Oct 26, 2002 [[User:Jheijmans|Jheijmans]] deleted "Albert Luthuli" <em>(empty, prev \" opgreLNÑ<N PEJNR wpj´mpo OPJ54W GWrou IOPNE ipoengklrek giopingre v9int n lh t3hioht\")</em> |
|||
#12:09 Oct 26, 2002 [[User:JeLuF|JeLuF]] deleted "Matabele" <em>(Content: \"????\")</em> |
|||
#07:18 Oct 26, 2002 [[User:JeLuF|JeLuF]] deleted "Mars bar" <em>(Content: \"Put your text for the new page here.adsasdasd\")</em> |
|||
#07:17 Oct 26, 2002 [[User:JeLuF|JeLuF]] deleted "IEEE 802.10" <em>(Content: \"IEEE 802.10\")</em> |
|||
#05:18 Oct 26, 2002 [[User:The Cunctator|The Cunctator]] deleted "Image:Paul Wellstone.jpg" <em>(Not nec. public domain. I uploaded it.)</em> |
|||
#22:41 Oct 25, 2002 [[User:Ed Poor|Ed Poor]] deleted "Talk:Ded reckoning" <em>(page was moved -- nothing links here)</em> |
|||
#22:09 Oct 25, 2002 [[User:JeLuF|JeLuF]] deleted "Mo Vaughn" <em>(Content: \"Again, how we can forget Chili Davis?? \")</em> |
|||
#22:08 Oct 25, 2002 [[User:JeLuF|JeLuF]] deleted "Wally Joyner" <em>(Content: \"what about Chili Davis?? \")</em> |
|||
#21:03 Oct 25, 2002 [[User:JeLuF|JeLuF]] deleted "Mark Shuttleworth" <em>(Content was random noise)</em> |
|||
#21:00 Oct 25, 2002 [[User:JeLuF|JeLuF]] deleted "Portal circulation" <em>(Content: \"Put your text for the new page here. anastomosis porto-cava \")</em> |
|||
#20:51 Oct 25, 2002 [[User:JeLuF|JeLuF]] deleted "Random number generator" <em>(Content: \"i don\'t want anything from you. just tell me what i told you before. \")</em> |
|||
#20:13 Oct 25, 2002 [[User:Tarquin|Tarquin]] deleted "Babylonian numerals" <em>(junk entry)</em> |
|||
#19:16 Oct 25, 2002 [[User:Sjc|Sjc]] deleted "User:193.251.9.132 is back for more" <em>(Vandalism)</em> |
|||
#19:15 Oct 25, 2002 [[User:Koyaanis Qatsi|Koyaanis Qatsi]] deleted "Image:Hello.jpg" <em>(goatse image from 193.251.9.132 is back for more)</em> |
|||
#19:15 Oct 25, 2002 [[User:Sjc|Sjc]] deleted "Image:Hello.jpg" <em>(Vandalism)</em> |
|||
#19:12 Oct 25, 2002 [[User:Koyaanis Qatsi|Koyaanis Qatsi]] deleted "Image:Widening" <em>(not an image but text: \"<b>It tastes like chicken, only with secret sause</b>!\")</em> |
|||
#19:01 Oct 25, 2002 [[User:Koyaanis Qatsi|Koyaanis Qatsi]] deleted "Wikipedia:Ram-man" <em>(\"um, yes, i spam wikipedia with useless autogenerated pages of US villages that no one gives a flying fuck about, please block me. I am insane! \" -- more from 193.251.9.132)</em> |
|||
⚫ | #18:49 Oct 25, 2002 [[User:Sjc|Sjc]] deleted "Klerckistheuberleetpagewidening-g0d-he-is-a-true-hax0r-he-forces-cmdrtaco-to-eat-feaces-because-he-is-sofucking-great-i-wonder-how-long-i-can-make-a-subject-be-fore-wikipedia-fux0rz-up-or-before-mozilla-does-it-probably-can-go-on-for-fucking-forever-if-i-" <em>(Completely irredeemable nonsense. Amusing title nevertheless.)</em> |
||
<li>19:01 Oct 25, 2002 [[User:Koyaanis Qatsi|Koyaanis Qatsi]] deleted "Wikipedia:Ram-man" <em>(\"um, yes, i spam wikipedia with useless autogenerated pages of US villages that no one gives a flying fuck about, please block me. I am insane! \" -- more from 193.251.9.132)</em></li> |
|||
#18:43 Oct 25, 2002 [[User:Koyaanis Qatsi|Koyaanis Qatsi]] deleted "Klerckistheuberleetpagewidening-g0d-he-is-a-true-hax0r-he-forces-cmdrtaco-to-eat-feaces-because-he-is-sofucking-great-i-wonder-how-long-i-can-make-a-subject-be-fore-wikipedia-fux0rz-up-or-before-mozilla-does-it-probably-can-go-on-for-fucking-forever-if-i-" <em>(Klerck, you are so l33t, i LOVE Page widening. g to the oatse c to the issex you are so fucking cool that i SHAT my pantx0rz )</em> |
|||
#18:29 Oct 25, 2002 [[User:Jheijmans|Jheijmans]] deleted "Path integral" <em>(\" The amount of hamburgers one man can eat in a day.\")</em> |
|||
⚫ | |||
#18:29 Oct 25, 2002 [[User:Jheijmans|Jheijmans]] deleted "Statistical distribution" <em>(\"Put your text for the new page here.extreme value \")</em> |
|||
#18:28 Oct 25, 2002 [[User:Jheijmans|Jheijmans]] deleted "Precious metal" <em>(\"Precious metals include gold, platinum, and silver. \"\")</em> |
|||
#18:26 Oct 25, 2002 [[User:Jheijmans|Jheijmans]] deleted "Joel David Bondurant" <em>(\"A famous american mathematician. \")</em> |
|||
#18:26 Oct 25, 2002 [[User:Jheijmans|Jheijmans]] deleted "Buffalo Bill" <em>(\"alias William Frederick Cody \")</em> |
|||
#18:26 Oct 25, 2002 [[User:Jheijmans|Jheijmans]] deleted "Phylogenetic tree" <em>(\" this is retarded \")</em> |
|||
#18:26 Oct 25, 2002 [[User:Jheijmans|Jheijmans]] deleted "Residue" <em>(\"Chewing Tobacco \")</em> |
|||
#18:25 Oct 25, 2002 [[User:Jheijmans|Jheijmans]] deleted "Distance-vector routing protocol" <em>(\" helloooooooooooo \")</em> |
|||
#18:25 Oct 25, 2002 [[User:Jheijmans|Jheijmans]] deleted "Concordance" <em>(empty, prev \" Put your text for the new page here. genitive \")</em> |
|||
#18:22 Oct 25, 2002 [[User:Jheijmans|Jheijmans]] deleted "Cross-country running" <em>(\"Emily\")</em> |
|||
#18:21 Oct 25, 2002 [[User:Jheijmans|Jheijmans]] deleted "Royal Tombs of Ur" <em>(\"u suck \")</em> |
|||
#18:21 Oct 25, 2002 [[User:Jheijmans|Jheijmans]] deleted "Pictograph" <em>(\"damion\")</em> |
|||
#18:21 Oct 25, 2002 [[User:Jheijmans|Jheijmans]] deleted "Allotheria" <em>(\"allotheria\")</em> |
|||
#18:21 Oct 25, 2002 [[User:Jheijmans|Jheijmans]] deleted "Retrograde extrapolation" <em>(empty, prev \" http://www.duicenter.com/ \")</em> |
|||
#18:21 Oct 25, 2002 [[User:Jheijmans|Jheijmans]] deleted "Retrograde extrapolation" <em>(empty, prev \" http://www.duicenter.com/ \")</em> |
|||
#18:20 Oct 25, 2002 [[User:Jheijmans|Jheijmans]] deleted "Cape Fear" <em>(empty, prev \"Put your text for the new page here. the cape fear \")</em> |
|||
#18:20 Oct 25, 2002 [[User:Jheijmans|Jheijmans]] deleted "Pierre Sauvignon de Brazza" <em>(empty, prev \"picture\")</em> |
|||
#15:50 Oct 25, 2002 [[User:Andre Engels|Andre Engels]] deleted "Sulfide" <em>(misnamed page, was about copper sulfides rather than sulfides in general; page and history moved to copper sulfide)</em> |
|||
#15:48 Oct 25, 2002 [[User:Andre Engels|Andre Engels]] deleted "Cupper sulfide" <em>(moved to wrong title; contents and history moved to copper sulfide)</em> |
|||
#09:35 Oct 25, 2002 [[User:Magnus Manske|Magnus Manske]] deleted "Markov algorithm" <em>(just created, empty)</em> |
|||
#08:47 Oct 25, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Mahmud I" <em>(garbage - the wikipedia is not a homework completion service)</em> |
|||
#00:27 Oct 25, 2002 [[User:Koyaanis Qatsi|Koyaanis Qatsi]] deleted "Locro" <em>(Hey, my homies, wazzup? If u wanna be a hot chica go to ecuador where you can get tan and lean form the beaches and stuff... )</em> |
|||
#00:26 Oct 25, 2002 [[User:Koyaanis Qatsi|Koyaanis Qatsi]] deleted "Marching music" <em>(Rach D smells )</em> |
|||
#21:18 Oct 24, 2002 [[User:JeLuF|JeLuF]] deleted "On-Line Medical Dictionary" <em>(Former content: \"http://cancerweb.ncl.ac.uk/omd/ \", now empty)</em> |
|||
#21:17 Oct 24, 2002 [[User:JeLuF|JeLuF]] deleted "Bureau of Standards" <em>(Content: \"Put your text for the new page here. wahaha \")</em> |
|||
#21:16 Oct 24, 2002 [[User:JeLuF|JeLuF]] deleted "Frozen Four" <em>(Content: \"this game rocks my dick \")</em> |
|||
#21:15 Oct 24, 2002 [[User:JeLuF|JeLuF]] deleted "The Fall of the House of Usher" <em>(Content: \"Hi i like eggs \")</em> |
|||
#21:13 Oct 24, 2002 [[User:JeLuF|JeLuF]] deleted "Minbar" <em>(Content: \"Hull middle from duluth, Georgia rocks! \")</em> |
|||
#21:13 Oct 24, 2002 [[User:JeLuF|JeLuF]] deleted "John Purroy Mitchel" <em>(Content: random noise)</em> |
|||
#21:12 Oct 24, 2002 [[User:JeLuF|JeLuF]] deleted "FFS" <em>(Content: \"editing ffs\")</em> |
|||
Hull middle from duluth, Georgia rocks! \")</em></li> |
|||
#18:50 Oct 24, 2002 [[User:The Cunctator|The Cunctator]] deleted "Talk:Beltway Sniper" <em>(same as subject page.)</em> |
|||
#18:49 Oct 24, 2002 [[User:The Cunctator|The Cunctator]] deleted "Beltway Sniper" <em>(Moving back to singular. Only one sniper.)</em> |
|||
#17:26 Oct 24, 2002 [[User:Ed Poor|Ed Poor]] deleted "Keep on trollin trollin trollin" <em>(graffiti)</em> |
|||
#17:23 Oct 24, 2002 [[User:Koyaanis Qatsi|Koyaanis Qatsi]] deleted "Image:Hello.jpg" <em>(goatse image)</em> |
|||
#14:08 Oct 24, 2002 [[User:Jheijmans|Jheijmans]] deleted "Sunne" <em>(needed for another page, is redirect)</em> |
|||
#13:42 Oct 24, 2002 [[User:Jheijmans|Jheijmans]] deleted "-lvsbyn" <em>(accidentally created by me)</em> |
|||
#13:14 Oct 24, 2002 [[User:Jheijmans|Jheijmans]] deleted "Berg" <em>(needed for another page, redirect to Alban Berg (not used))</em> |
|||
#08:01 Oct 24, 2002 [[User:Koyaanis Qatsi|Koyaanis Qatsi]] deleted "THX 1138:4EB" <em>(Put your text for the new page here. hi )</em> |
|||
#07:42 Oct 24, 2002 [[User:Jheijmans|Jheijmans]] deleted "Rustler's knot" <em>(\"instructions for tying a rustler\'s knot\")</em> |
|||
#07:41 Oct 24, 2002 [[User:Jheijmans|Jheijmans]] deleted "Duotrigintillion" <em>(\"Put your text for the new page here.\")</em> |
|||
#07:41 Oct 24, 2002 [[User:Jheijmans|Jheijmans]] deleted "Mudhoney" <em>(empty, prev \"Mudhuney sucks.\")</em> |
|||
#07:40 Oct 24, 2002 [[User:Jheijmans|Jheijmans]] deleted "Geheimfernschreiber" <em>(empty, prev \"This is a test of the geheimfernschreiber code used by nazis in 1943. This test will be used in a report by Craig Warren in a report for praxis module year 1 computer science, Heriot Watt University.\")</em> |
|||
#07:40 Oct 24, 2002 [[User:Jheijmans|Jheijmans]] deleted "Projection" <em>(empty, prev \"Put hfgh\")</em> |
|||
#07:40 Oct 24, 2002 [[User:Jheijmans|Jheijmans]] deleted "Channel 5/UK" <em>(empty, prev \"Put your text for the new page here. rah\")</em> |
|||
#06:54 Oct 24, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Simon peters" <em>(Non-article; only content \"simon peters was found being gay with a boy nnamed andy collalo\")</em> |
|||
#04:07 Oct 24, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Waring's problem" <em>(Cut-n-paste from [[Warings problem]]. Need to delete it to make room for a proper rename of the article with history intact)</em> |
|||
#03:08 Oct 24, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Propaganda/Slogans" <em>(Non-article; only content \"Put your text for the new page here. asdasdasd\")</em> |
|||
#00:02 Oct 24, 2002 [[User:Lee Daniel Crocker|Lee Daniel Crocker]] deleted "Fred Olsen" <em>(Similar random vandal page-creation.)</em> |
|||
#00:00 Oct 24, 2002 [[User:Lee Daniel Crocker|Lee Daniel Crocker]] deleted "James Rosenquist" <em>(No content, no history, random vandal.)</em> |
|||
#23:22 Oct 23, 2002 [[User:Lee Daniel Crocker|Lee Daniel Crocker]] deleted "Minoan civilization" <em>(Preparing for move)</em> |
|||
#22:26 Oct 23, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Logging file system" <em>(Non-article; only content \"???????\")</em> |
|||
#21:08 Oct 23, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Bloomingberg, ohio" <em>(More goatse.cx)</em> |
|||
#20:44 Oct 23, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Wikipedia:VANDALISMS IN PROGRESS" <em>(More goatse.cx)</em> |
|||
#20:34 Oct 23, 2002 [[User:JeLuF|JeLuF]] deleted "Gonville Hall, Cambridge" <em>(Content was: \"Go\")</em> |
|||
#20:33 Oct 23, 2002 [[User:Maveric149|Maveric149]] deleted "Spelling" <em>(Put your text for the new page here. Thank you very much for your letter of support. It will be a pleasure to inform you when this project becomes available. )</em> |
|||
<li>20:44 Oct 23, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Wikipedia:VANDALISMS IN PROGRESS" <em>(More goatse.cx)</em></li> |
|||
#20:33 Oct 23, 2002 [[User:JeLuF|JeLuF]] deleted "Morton's Fork" <em>(Content was: \"test\")</em> |
|||
#20:32 Oct 23, 2002 [[User:JeLuF|JeLuF]] deleted "User:0" <em>(empty page, deletion requested by Ortolan88)</em> |
|||
#20:29 Oct 23, 2002 [[User:Ed Poor|Ed Poor]] deleted "The weather in London" <em>(messing up the Wikipedia FAQ)</em> |
|||
#20:21 Oct 23, 2002 [[User:JeLuF|JeLuF]] deleted "Wikipedia:Sucks" <em>(showing only the goats.cx-image)</em> |
|||
#20:20 Oct 23, 2002 [[User:Ed Poor|Ed Poor]] deleted "Wikipedia:Sucks" <em>(You didn\'t say WHY it sucks)</em> |
|||
#18:27 Oct 23, 2002 [[User:Maveric149|Maveric149]] deleted "Pyramid of Djoser" <em>(Getting this out of the way for a move back (Please read our naming conventions)</em> |
|||
#17:43 Oct 23, 2002 [[User:Stephen Gilbert|Stephen Gilbert]] deleted "Compound microscope" <em>(solitation for cyber-sex)</em> |
|||
#17:23 Oct 23, 2002 [[User:Stephen Gilbert|Stephen Gilbert]] deleted "Tillibody" <em>(obscure advertisement; deletion requested)</em> |
|||
#17:22 Oct 23, 2002 [[User:Stephen Gilbert|Stephen Gilbert]] deleted "Tagmemics" <em>(copyright violation)</em> |
|||
#09:59 Oct 23, 2002 [[User:Andre Engels|Andre Engels]] deleted "John Fahey" <em>(\"This person is weird\")</em> |
|||
#08:10 Oct 23, 2002 [[User:Jheijmans|Jheijmans]] deleted "Pet Sounds" <em>(\"The first psychedellic album ever released.\")</em> |
|||
#08:10 Oct 23, 2002 [[User:Jheijmans|Jheijmans]] deleted "Vince Clarke" <em>(\"First synth player for Depeche Mode.\")</em> |
|||
#08:10 Oct 23, 2002 [[User:Jheijmans|Jheijmans]] deleted "Charles Augustin de Coulumb" <em>(\"hey guys!\")</em> |
|||
#08:09 Oct 23, 2002 [[User:Jheijmans|Jheijmans]] deleted "Chuck Norris" <em>(empty, prev \"Chuck Norris was not a Marine, he served in the US Air Force and picked up his knowledge on Martial Art while stationed in Korea\")</em> |
|||
#01:23 Oct 23, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Beltway Sniper" <em>(History is only cut-n-paste from [[Washington sniper]]. Need to remove to rename that article here.)</em> |
|||
#01:13 Oct 23, 2002 [[User:Koyaanis Qatsi|Koyaanis Qatsi]] deleted "Delete" <em>(some oddness that came about from some action of Lir\'s--intentional or not, I don\'t know)</em> |
|||
#01:13 Oct 23, 2002 [[User:Koyaanis Qatsi|Koyaanis Qatsi]] deleted "Dqwe" <em>(some oddness that came about from some action of Lir\'s--intentional or not, I don\'t know)</em> |
|||
#01:12 Oct 23, 2002 [[User:Koyaanis Qatsi|Koyaanis Qatsi]] deleted "Delete3432432" <em>(some oddness that came about from some action of Lir\'s--intentional or not, I don\'t know)</em> |
|||
#01:12 Oct 23, 2002 [[User:Koyaanis Qatsi|Koyaanis Qatsi]] deleted "Delete123" <em>(some oddness that came about from some action of Lir\'s--intentional or a bug, I don\'t know)</em> |
|||
#00:52 Oct 23, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Cock" <em>(no actual info)</em> |
|||
#00:50 Oct 23, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Hillel Slovak" <em>(the guy from the red hot chillio peppers )</em> |
|||
#00:49 Oct 23, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Surf Punks" <em>(Local surfers into punk music & lifestyle. )</em> |
|||
#00:48 Oct 23, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Bass rap" <em>(vandalism)</em> |
|||
#00:47 Oct 23, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Sir Andrew Ramsay" <em>(asking for information)</em> |
|||
#00:45 Oct 23, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Sali Berisha" <em>(foreign language microstub)</em> |
|||
#00:42 Oct 23, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Petronius" <em>(no content)</em> |
|||
#00:07 Oct 23, 2002 [[User:Andre Engels|Andre Engels]] deleted "Spiral galaxy" <em>(\"Put your text for the new page here.fuuuuuuuuuuuuuuuuuuuuuuuuucccccccccccccccckkkkkkkkkkkkkkkkkkyyyyyyyyyyyyyyyyoooooooooooooooouuuuuuuuuuuuuu\" )</em> |
|||
#00:06 Oct 23, 2002 [[User:Andre Engels|Andre Engels]] deleted "Cervidae" <em>(\"no one likes you\")</em> |
|||
#00:05 Oct 23, 2002 [[User:Andre Engels|Andre Engels]] deleted "Swiss Market" <em>(\"Put your text for the new page here. market capitalization\")</em> |
|||
#00:03 Oct 23, 2002 [[User:Andre Engels|Andre Engels]] deleted "William Rushton" <em>(\"Put your text for the new page here. ???\")</em> |
|||
#19:47 Oct 22, 2002 [[User:Tarquin|Tarquin]] deleted "Lalalalalala" <em>(stupid name.)</em> |
|||
#19:26 Oct 22, 2002 [[User:Andre Engels|Andre Engels]] deleted "Red River (of the South)" <em>(\"fgdfgdfgsfdsdfsfdsfdgsfdgsdfgsdfgsfdgsdfgsfdgsdfdfgffsfgsfdsfggsffgfdgsdfgsfgsfgsfgf\")</em> |
|||
#18:17 Oct 22, 2002 [[User:Isis|Isis]] deleted "Image:Janegrey.jpg" <em>(misspelled name)</em> |
|||
#13:14 Oct 22, 2002 [[User:Isis|Isis]] deleted "Matrix(Mathematics)" <em>(it was an error, should have had a space, the article is on the right page)</em> |
|||
#08:38 Oct 22, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Grauspitze" <em>(non-article by 62.254.203.161: \"we want some pictures and ways to get up to the top of the peak,please help us!!!\")</em> |
|||
#08:07 Oct 22, 2002 [[User:Jheijmans|Jheijmans]] deleted "James Richard Cross" <em>(empty, prev \"Put your text for the new page here. he rules\")</em> |
|||
#08:06 Oct 22, 2002 [[User:Jheijmans|Jheijmans]] deleted "Governor-General's Award for Creative Non-Fiction" <em>(empty, prev \"\" Famous People\")</em> |
|||
#08:06 Oct 22, 2002 [[User:Jheijmans|Jheijmans]] deleted "2196" <em>(empty, prev \"Alex R. arrived to receive his punishment after he was captured by jeung san do authorities in 1996 and tempoted forward in time to 2196.\")</em> |
|||
#08:06 Oct 22, 2002 [[User:Jheijmans|Jheijmans]] deleted "Hegemon" <em>(empty, prev \"meh\")</em> |
|||
#08:06 Oct 22, 2002 [[User:Jheijmans|Jheijmans]] deleted "Knuths up-arrow notation" <em>(\"Uh, what is this?\")</em> |
|||
#08:05 Oct 22, 2002 [[User:Jheijmans|Jheijmans]] deleted "Sparks, Nevada" <em>(\"Sparks is a city in Nevada that borders Reno.\")</em> |
|||
#08:04 Oct 22, 2002 [[User:Jheijmans|Jheijmans]] deleted "Talk:OMW" <em>(talk of deleted page)</em> |
|||
#08:03 Oct 22, 2002 [[User:Jheijmans|Jheijmans]] deleted "OMW" <em>(commercial crap in Spanish)</em> |
|||
#05:39 Oct 22, 2002 [[User:Maveric149|Maveric149]] deleted "Dispatcher" <em>(This is a window )</em> |
|||
#05:07 Oct 22, 2002 [[User:Maveric149|Maveric149]] deleted "Munich" <em>(getting this out of the way for yet another move back )</em> |
|||
#04:47 Oct 22, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Talk:Christopher Columbus" <em>(Need to delete to put actual talk page with its history back in place)</em> |
|||
#04:42 Oct 22, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Christopher Columbus" <em>(No history; need to remove to put the real article back from accidentally misspelled title)</em> |
|||
#03:25 Oct 22, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Gerdy The Dinosaur" <em>(Lir made it, and Lir wanted it deleted)</em> |
|||
#00:16 Oct 22, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Hab Theory" <em>(just a weblink, by 12.224.24.9)</em> |
|||
#00:04 Oct 22, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Drez" <em>(by 200.52.162.1, just a weblink)</em> |
|||
#20:51 Oct 21, 2002 [[User:Tarquin|Tarquin]] deleted "Chronicle of a Death Foretold" <em>(junk entry)</em> |
|||
#18:18 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "Talk:List of famous people who had sex with animals" <em>(moved to meta)</em> |
|||
#18:18 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "Talk:Benjamin Netanyahu On Terrorism" <em>(moved to meta)</em> |
|||
#18:17 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "Talk:Viral meme" <em>(contents moved to meta)</em> |
|||
#18:14 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "39/Smooth" <em>(copyright violation)</em> |
|||
#18:14 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "Kerplunk" <em>(copyright violation)</em> |
|||
#18:14 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "Alice Cooper" <em>(copyright violation)</em> |
|||
#18:14 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "PLATO game Spasim" <em>(copyright violation)</em> |
|||
#18:13 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "Hermann Koehl" <em>(copyright violation)</em> |
|||
#18:13 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "Hawkwind/Quark, Strangeness and Charm" <em>(personal review)</em> |
|||
#18:11 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "Alexander Girard" <em>(copyright violation)</em> |
|||
#18:09 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "George Nelson" <em>(copyright violation)</em> |
|||
#18:09 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "Ray Ozzie" <em>(copyright violation)</em> |
|||
#18:09 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "Herman Miller" <em>(copyright violation)</em> |
|||
#18:09 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "Gilbert Rohde" <em>(copyright violation)</em> |
|||
#18:09 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "Charles and Ray Eames" <em>(copyright violation)</em> |
|||
#18:09 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "Isamu Noguchi" <em>(copyright violation)</em> |
|||
#18:08 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "Gary Barwin" <em>(copyright violation)</em> |
|||
#18:07 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "El Elote" <em>(\"ES UN PERRON PARA EL RAP MEXICANO, UNA MEXCLA ENTRE VARIOS ESTILOS GANSTA Y HIP HOP Y ALGO DE RAGGA.\")</em> |
|||
#18:06 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "Slaughterhouse Five" <em>(\"SLAUGHTERHOUSE-FIVE or The Children\'s Crusade (a duty-dance with death) + contents\")</em> |
|||
#18:06 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "IHTFP" <em>(\"IHTFP means I Hate This F***ing Place. It is the popular motto of students who attend MIT\")</em> |
|||
#18:02 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "Anthony M. Buzzelli" <em>(\"please update link to http://home.cogeco.ca/~abuzzelli/\")</em> |
|||
#18:02 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "The weather in London" <em>(\"Actually this page does exist. (etc)\")</em> |
|||
#18:00 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "East of Eden" <em>(\"Alyssa loves Taylor\")</em> |
|||
#17:02 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "Bergen, Netherlands" <em>(deleting incorrect page, created by me today)</em> |
|||
#16:11 Oct 21, 2002 [[User:Maveric149|Maveric149]] deleted "Munich" <em>(getting this page out of the way for a move back)</em> |
|||
#13:06 Oct 21, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Motorola 68012" <em>(newbie experiment)</em> |
|||
#12:03 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "Frederic Rzewski" <em>(\"Surprisingly, an American composer.\")</em> |
|||
#12:02 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "Platonic dialogues" <em>(\"socratic irony\")</em> |
|||
#12:02 Oct 21, 2002 [[User:Jheijmans|Jheijmans]] deleted "Larry Brown" <em>(empty, prev \"lalalala etc.\")</em> |
|||
#11:58 Oct 21, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "KWOC" <em>(irrelevancy by 163.117.53.82: \"el cochecito de color rojo vino por la carrtera de Boadilla\")</em> |
|||
#07:02 Oct 21, 2002 [[User:Maveric149|Maveric149]] deleted "Hybrid monolithic kernel" <em>(Put your text for the new page here.rtrete )</em> |
|||
#07:02 Oct 21, 2002 [[User:Maveric149|Maveric149]] deleted "Bus mastering" <em>(Bus mastering )</em> |
|||
#05:36 Oct 21, 2002 [[User:Maveric149|Maveric149]] deleted "Tungsten/Temp" <em>(Temp page used only for conversion)</em> |
|||
#04:40 Oct 21, 2002 [[User:Maveric149|Maveric149]] deleted "Middle German" <em>(hello )</em> |
|||
#04:36 Oct 21, 2002 [[User:Maveric149|Maveric149]] deleted "Dave Farrel" <em>(dave is a ferrell slut )</em> |
|||
#02:30 Oct 21, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Xu language" <em>(Non-article; no history, entire contents \"Hi my name is meri\")</em> |
|||
#02:22 Oct 21, 2002 [[User:Maveric149|Maveric149]] deleted "Talk:Omagh bombing" <em>(just a heated comment ; removed by request from the person who wrote it)</em> |
|||
#22:16 Oct 20, 2002 [[User:Jheijmans|Jheijmans]] deleted "Hygroscopic" <em>(\"Hygroscopic substances readily absorb water.\")</em> |
|||
#22:16 Oct 20, 2002 [[User:Jheijmans|Jheijmans]] deleted "Andrew Hartzell" <em>(\"- One of many Midcoast and SPNC founders.\")</em> |
|||
#22:15 Oct 20, 2002 [[User:Jheijmans|Jheijmans]] deleted "Rodney Moore" <em>(\"Put your text for the new page here.\")</em> |
|||
#22:15 Oct 20, 2002 [[User:Jheijmans|Jheijmans]] deleted "Oyster" <em>(\"See also: How to cook oysters\")</em> |
|||
#22:14 Oct 20, 2002 [[User:Jheijmans|Jheijmans]] deleted "Turbulence" <em>(\"Disturbance in the fluid motion.\")</em> |
|||
#22:14 Oct 20, 2002 [[User:Jheijmans|Jheijmans]] deleted "Langjökull" <em>(\"Langjökull, size 1.021 sq.kms.\")</em> |
|||
#22:14 Oct 20, 2002 [[User:Jheijmans|Jheijmans]] deleted "Hofsjökull" <em>(\"Hofsjökull, size 994 sq.kms.\")</em> |
|||
#22:13 Oct 20, 2002 [[User:Jheijmans|Jheijmans]] deleted "Vatnajökull" <em>(\"Vatnajökull, size 8.456 sq.kms\")</em> |
|||
#22:13 Oct 20, 2002 [[User:Jheijmans|Jheijmans]] deleted "Absurd" <em>(Essay moved to m:absurd)</em> |
|||
#22:13 Oct 20, 2002 [[User:Jheijmans|Jheijmans]] deleted "Auguste Comte" <em>(empty, prev \"Put your text for the new page here. HEy Ya\'all!!! What\'s kickin???\")</em> |
|||
#22:13 Oct 20, 2002 [[User:Jheijmans|Jheijmans]] deleted "King Bowser Koopa" <em>(empty, prev \"Redirect to Bowser.\")</em> |
|||
#22:13 Oct 20, 2002 [[User:Jheijmans|Jheijmans]] deleted "Transylvanian Saxon" <em>(empty, prev \"hello, how are you?\")</em> |
|||
#22:12 Oct 20, 2002 [[User:Jheijmans|Jheijmans]] deleted "Mercury-in-glass thermometer" <em>(\"GAY SHIT U R\")</em> |
|||
#22:12 Oct 20, 2002 [[User:Jheijmans|Jheijmans]] deleted "Top-down design" <em>(empty, \"Put your text for the new page here. ghghggg hjkhjk\")</em> |
|||
#22:11 Oct 20, 2002 [[User:Jheijmans|Jheijmans]] deleted "Kid" <em>(delete requested by Rlee0001)</em> |
|||
#22:10 Oct 20, 2002 [[User:Jheijmans|Jheijmans]] deleted "Nikolay Nikolaevich Semenov" <em>(empty, prev \"He was one bitch ass Russian.\")</em> |
|||
#14:35 Oct 20, 2002 [[User:Tarquin|Tarquin]] deleted "Spatial tense" <em>(empty, no content in history)</em> |
|||
#13:13 Oct 20, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Habib Bourguiba" <em>(junk by 193.194.75.6: \"hassal maaneh!\")</em> |
|||
#13:12 Oct 20, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Talk:Laura Welch Bush" <em>(irrelevancy by 193.194.75.6: \"do not smok to match salem cig smok can dam your healt a tortoise.\")</em> |
|||
#13:10 Oct 20, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Adelbert von Chamisso" <em>(nonsense by 193.194.75.6: \"chimia\")</em> |
|||
#13:10 Oct 20, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Derg" <em>(junk by 193.194.75.6: \"la griffe d\'or\")</em> |
|||
#07:42 Oct 20, 2002 [[User:Maveric149|Maveric149]] deleted "Fritz Perls" <em>(Fritz Perl, great guy )</em> |
|||
#04:32 Oct 20, 2002 [[User:Maveric149|Maveric149]] deleted "Tantalum/Temp" <em>(Temp page used only for conversion)</em> |
|||
#02:32 Oct 20, 2002 [[User:The Epopt|The Epopt]] deleted "List of articles not about philosophy" <em>(no content, no history)</em> |
|||
#02:30 Oct 20, 2002 [[User:The Epopt|The Epopt]] deleted "Category experiment" <em>(no content, no history, no nothing nohow)</em> |
|||
#20:49 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Carlow" <em>(redirect to non-existing page)</em> |
|||
#20:49 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "José Ferrer" <em>(redirect to non-existing page)</em> |
|||
#20:49 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Coal/History" <em>(redirect to non-existing page)</em> |
|||
#20:49 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Turkmenistan/Human rights issues" <em>(redirect to non-existing page)</em> |
|||
#20:48 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "MeaningfulNess" <em>(redirect to non-existing page)</em> |
|||
#20:48 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Shepherds Bush" <em>(redirect to non-existing page)</em> |
|||
#20:46 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Italian Communist Party" <em>(redirect to non-existing page)</em> |
|||
#20:46 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Fundamental dimensions/Comments" <em>(redirect to non-existing page)</em> |
|||
#20:46 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Monaghan" <em>(redirect to non-existing page)</em> |
|||
#20:46 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "The Hanged Man" <em>(redirect to non-existing page)</em> |
|||
#20:46 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Go proverb" <em>(redirect to non-existing page)</em> |
|||
#20:45 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Mike Dill/My ideas on socital change and terrorism" <em>(redirect to non-existing page)</em> |
|||
#20:44 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Cavan" <em>(redirect to non-existing page)</em> |
|||
#20:44 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "McMahon Act" <em>(redirect to non-existing page)</em> |
|||
#20:43 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Writ of Certiorari" <em>(redirect to non-existing page)</em> |
|||
#20:43 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Sanguozhi" <em>(redirect to non-existing page)</em> |
|||
#20:42 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "NAGPRA" <em>(redirect to non-existing page)</em> |
|||
#20:42 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Ozarks" <em>(redirect to non-existing page)</em> |
|||
#20:42 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "James Barrie" <em>(redirect to non-existing page)</em> |
|||
#20:41 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Fuller Seminary" <em>(redirect to non-existing page)</em> |
|||
#20:41 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Erichtheus" <em>(redirect to non-existing page)</em> |
|||
#20:41 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Human rights abuses" <em>(redirect to non-existing page)</em> |
|||
#20:40 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "C-47 Dakota" <em>(redirect to non-existing page)</em> |
|||
#20:39 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "C-47 Gooney Bird" <em>(redirect to non-existing page)</em> |
|||
#20:11 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "NormanWerner" <em>(personal page with only e-mail addresses and nonsense)</em> |
|||
#20:08 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Propaganda/Slogans" <em>(\"terrell ate danee out \")</em> |
|||
#20:07 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Reel-to-Reel" <em>(Put your text for the new page here. red apple )</em> |
|||
#20:01 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Microdot" <em>(empty, prev \"Alabama \")</em> |
|||
#20:00 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "CPM-86" <em>(empty, prev \" YOU SUCK!\" (in H1-tags))</em> |
|||
#20:00 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Talk:Millinery" <em>(talk of removed page)</em> |
|||
#20:00 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Millinery" <em>(empty \"this is strange very strange so strange it is beyond human means to describe the strangeness strange strange it is strange and that is the truth\")</em> |
|||
#20:00 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "2205 BC" <em>(empty, prev \"1000000000000000000000000000000000000000000000000000000 \")</em> |
|||
#19:59 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Mikrophunk" <em>(empty, prev \"los chilangos que estan sonando mas duro...... \")</em> |
|||
#19:59 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Gundobad" <em>(empty, prev \"Gundobada \")</em> |
|||
#19:59 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Best-first search" <em>(empty, prev \"Put your text for the new page here. ok \")</em> |
|||
#19:58 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Talk:Philip III of Spain" <em>(talk of removed page)</em> |
|||
#19:58 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Philip III of Spain" <em>(empty, prev \" Ate peaches for fun. I love peaches. Look at these! They are peaches. \" )</em> |
|||
#19:58 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Ferdinand I, Holy Roman Emperor" <em>(empty, prev \"Go to the pep rally with Ferdinand I. \")</em> |
|||
#19:55 Oct 19, 2002 [[User:Jheijmans|Jheijmans]] deleted "Jun Fan" <em>(empty, prev \"Put your text for the new page here. jjiilkl \" )</em> |
|||
#18:01 Oct 19, 2002 [[User:Maveric149|Maveric149]] deleted "Siemens Nixdorf Informationssysteme AG" <em>(sdfg)</em> |
|||
#17:38 Oct 19, 2002 [[User:Maveric149|Maveric149]] deleted "Liaotung Peninsula" <em>(Put your text for the new page here. liaotung peninsula is cool )</em> |
|||
#16:29 Oct 19, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Image:Test.phtml" <em>(also only says \"<? phpinfo() ?>\")</em> |
|||
#16:25 Oct 19, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Image:Test.php" <em>(orphan file uploaded by Testtest; only text \"<? phpinfo() ?>\")</em> |
|||
#16:17 Oct 19, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Image:PrattProfile1edit.txt" <em>(More Javascript by Jokerman)</em> |
|||
#16:15 Oct 19, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Image:PrattProfile1.txt" <em>(HTML with Javascript uploaded by known junk uploader Jokerman9001)</em> |
|||
#13:35 Oct 19, 2002 [[User:Koyaanis Qatsi|Koyaanis Qatsi]] deleted "Image:Djmangoo-themelody.ogg" <em>(doens\'t work, reports itself as 0 bytes)</em> |
|||
#13:34 Oct 19, 2002 [[User:Koyaanis Qatsi|Koyaanis Qatsi]] deleted "Image:SevenDayPrattProfile1.gif" <em>(image used for HTML page with improper extension, javascript, talks about hacking computers, quotes Churchill, other random junk)</em> |
|||
#13:33 Oct 19, 2002 [[User:Koyaanis Qatsi|Koyaanis Qatsi]] deleted "Image:SevenDayPrattProfile2.gif" <em>(image description page for image used in HTML page with improper extension, javascript, talks about hacking computers, quotes Churchill, other random junk)</em> |
|||
#13:33 Oct 19, 2002 [[User:Koyaanis Qatsi|Koyaanis Qatsi]] deleted "Image:SevenDayPrattProfile2.gif" <em>(image used in HTML page with improper extension, javascript, talks about hacking computers, quotes Churchill, other random junk)</em> |
|||
#13:32 Oct 19, 2002 [[User:Koyaanis Qatsi|Koyaanis Qatsi]] deleted "Image:PrattProfile1.txt" <em>(HTML page with improper extension, javascript, talks about hacking computers, quotes Churchill, other random junk)</em> |
|||
#13:32 Oct 19, 2002 [[User:Koyaanis Qatsi|Koyaanis Qatsi]] deleted "Image:PrattProfile1edit.txt" <em>(HTML page with improper extension, javascript, talks about hacking computers, quotes Churchill, other random junk)</em> |
|||
#09:52 Oct 19, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Bobby Bonds" <em>(garbage)</em> |
|||
#09:49 Oct 19, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Euramerica" <em>(gibberish)</em> |
|||
#09:48 Oct 19, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Hermeneutic" <em>(garbage)</em> |
|||
#09:13 Oct 19, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Microsoft SQL server" <em>(garbage)</em> |
|||
#08:54 Oct 19, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Maynard James Keenan" <em>(garbage)</em> |
|||
#08:27 Oct 19, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Macuxi" <em>(gibberish)</em> |
|||
#08:25 Oct 19, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Padborg" <em>(sole contents \'german speaking town\')</em> |
|||
⚫ | |||
⚫ | |||
#04:46 Oct 19, 2002 [[User:Koyaanis Qatsi|Koyaanis Qatsi]] deleted "A page that will never be written unless some jerk writes it" <em>(non-encyclopedic, should be left unwritten for [[wikipedia:how to start a page]] example)</em> |
|||
⚫ | |||
⚫ | |||
#01:19 Oct 19, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Parse tree" <em>(test by 151.203.58.43)</em> |
|||
#23:30 Oct 18, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Newbie" <em>(Vandalism by 203.166.96.234, now blocked. Only text \"UP YOURS! NIGGER!\".)</em> |
|||
#22:19 Oct 18, 2002 [[User:Maveric149|Maveric149]] deleted "Canadian Alliance" <em>(Getting this out of the way for a correct move)</em> |
|||
#22:05 Oct 18, 2002 [[User:Maveric149|Maveric149]] deleted "Thirteen Years' War" <em>(Getting this out of the way for a correct move)</em> |
|||
#21:18 Oct 18, 2002 [[User:Ed Poor|Ed Poor]] deleted "Univeristy of California, Berkeley" <em>(misspelling, nothing links here)</em> |
|||
#20:46 Oct 18, 2002 [[User:Lee Daniel Crocker|Lee Daniel Crocker]] deleted "Max Stirner" <em>(Preparing for move)</em> |
|||
#18:52 Oct 18, 2002 [[User:Maveric149|Maveric149]] deleted "Hawker Hunter" <em>(hawker hunter )</em> |
|||
#11:34 Oct 18, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Lindau" <em>(garbage)</em> |
|||
#11:33 Oct 18, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Ruma" <em>(gibberish)</em> |
|||
#11:32 Oct 18, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "KDD" <em>(gibberish)</em> |
|||
#11:31 Oct 18, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Law of conservation of matter" <em>(garbage)</em> |
|||
#10:38 Oct 18, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Asymmetric cryptography" <em>(garbage by 193.1.206.62: \"Put your text for the new page here. hi ya mary knkjoj\")</em> |
|||
#03:43 Oct 18, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Battle of Eylau" <em>(nonsense by 205.188.208.40: \"hi this was a great aritiv\")</em> |
|||
#00:03 Oct 18, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "My" <em>(garbage article by 12.39.89.31)</em> |
|||
#23:03 Oct 17, 2002 [[User:Andre Engels|Andre Engels]] deleted "Chilomonas" <em>(Full text: \"Stuff happens! Hey there Fhqwhgads! Hey there Fh-qw-h-gads! Everybody to the limit!\")</em> |
|||
#22:30 Oct 17, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "2208" <em>(nonsense prediction by 209.107.95.230)</em> |
|||
#22:28 Oct 17, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Water wheel" <em>(newbie calling attention to a typo in Pelton; fixed)</em> |
|||
#22:25 Oct 17, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "ASF" <em>(question from 141.155.124.102: \"What is an ASF file?\" Beats me; someone sent me one and I have no idea what to read it with.)</em> |
|||
#18:23 Oct 17, 2002 [[User:Maveric149|Maveric149]] deleted "Goedel's completeness theorem" <em>(need to get this out of the way for a more -- nothing but a redirect, no content in history)</em> |
|||
#13:51 Oct 17, 2002 [[User:Andre Engels|Andre Engels]] deleted "Soon" <em>(nonsense; moved to \"Bad Jokes etc.\")</em> |
|||
#12:34 Oct 17, 2002 [[User:Andre Engels|Andre Engels]] deleted "First Crusade" <em>(redirect without history; making place for a move)</em> |
|||
#12:00 Oct 17, 2002 [[User:Stephen Gilbert|Stephen Gilbert]] deleted "Wardian case" <em>(created by a bug, it seems)</em> |
|||
#01:51 Oct 17, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Christian Dior" <em>(nonsense by 203.108.4.66: \"Put your text for the new page here. ytytyrt\")</em> |
|||
#01:49 Oct 17, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Hybrid monolithic kernel" <em>(garbage by 64.48.234.45: \"Put your text for the new page here. tonima ,,h\")</em> |
|||
#01:15 Oct 17, 2002 [[User:Stephen Gilbert|Stephen Gilbert]] deleted "Turn-based game" <em>(\"put the text for the new page here\" plus a newbie test)</em> |
|||
#01:15 Oct 17, 2002 [[User:Stephen Gilbert|Stephen Gilbert]] deleted "Alain Mimoun" <em>(\"Put the text for the new page here\" plus a newbie test)</em> |
|||
#22:09 Oct 16, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Screen Actors Guild" <em>(newbie experiment by 205.188.209.171: only text \"weeeeeeeee\")</em> |
|||
#22:08 Oct 16, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Middle-Earth Roleplaying System" <em>(newbie experiment by 12.19.140.49: only text \"what the heck?\")</em> |
|||
#19:46 Oct 16, 2002 [[User:Tarquin|Tarquin]] deleted "Conspicuous consumption" <em>(junk entry. see my suggestion on the mailing list!)</em> |
|||
#15:53 Oct 16, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Scientific mythology" <em>(redirect without history; making place for a move)</em> |
|||
#15:53 Oct 16, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Scientific mythology" <em>(redirect without history; making place for a move)</em> |
|||
#15:52 Oct 16, 2002 [[User:Andre Engels|Andre Engels]] deleted "Scientific mythology" <em>(redirect without history; making place for a move)</em> |
|||
#15:48 Oct 16, 2002 [[User:Tarquin|Tarquin]] deleted "Blue Nile" <em>(junk entry)</em> |
|||
#15:33 Oct 16, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Hayden Christiansen" <em>(\"His name is Christensen, not Christiansen\" - page has now been moved)</em> |
|||
#15:27 Oct 16, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Millions of worthless articles" <em>(talk page to deleted page)</em> |
|||
#15:22 Oct 16, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Friends United Meeting" <em>(talk page to deleted page)</em> |
|||
#15:10 Oct 16, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Q Codes" <em>(\"his page can be deleted now that I have changed the referring links to point to Q Code.\" - subject page is a redirect to Q Code, which means this talk has been dealt with adequately)</em> |
|||
#11:53 Oct 16, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Thivai" <em>(junk by 202.67.64.154: \"thivai is cool!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!\")</em> |
|||
#11:40 Oct 16, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Travels With Charley" <em>(garbage by 152.163.189.170: long string of \'n\' and \'o\')</em> |
|||
<li>15:10 Oct 16, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Q Codes" <em>(\"his page can be deleted now that I have changed the referring links to point to Q Code.\" - subject page is a redirect to Q Code, which means this talk has been dealt with adequately)</em></li> |
|||
#11:38 Oct 16, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Problem domain" <em>(newbie experiment by 144.16.64.4: only text \"public range\")</em> |
|||
#11:22 Oct 16, 2002 [[User:Andre Engels|Andre Engels]] deleted "John Forbes Nash" <em>(redirect without history; making place for a move)</em> |
|||
#10:43 Oct 16, 2002 [[User:Jheijmans|Jheijmans]] deleted "The Oresteia" <em>(\"Classic depiction of the battle with Persia featuring Cassandra.\")</em> |
|||
#10:43 Oct 16, 2002 [[User:Jheijmans|Jheijmans]] deleted "Business management" <em>(\"The activity of managing a commercial enterprise or business.\")</em> |
|||
#10:42 Oct 16, 2002 [[User:Jheijmans|Jheijmans]] deleted "Ray Gillen" <em>(\"Recorded Eternal Idol, which was rerecorded with Tony Martin.\")</em> |
|||
#09:35 Oct 16, 2002 [[User:Andre Engels|Andre Engels]] deleted "Image:German flag 1815.png" <em>(Duplicate of Germany_flag_1815.png ; deletion requested by uploader)</em> |
|||
#09:33 Oct 16, 2002 [[User:Andre Engels|Andre Engels]] deleted "Xenon/Temp" <em>(Temp page; contents have already been moved to the main article)</em> |
|||
#08:09 Oct 16, 2002 [[User:Sjc|Sjc]] deleted "Amatol" <em>(Random garbage)</em> |
|||
#06:47 Oct 16, 2002 [[User:Jheijmans|Jheijmans]] deleted "Akron, Ohio" <em>(\"This is a specially made toilet located in ohio\")</em> |
|||
#06:47 Oct 16, 2002 [[User:Jheijmans|Jheijmans]] deleted "Penal code" <em>(\"Put your text for the new page here. ca\")</em> |
|||
#06:47 Oct 16, 2002 [[User:Jheijmans|Jheijmans]] deleted "Superstring" <em>(\"super strings!!!\")</em> |
|||
#06:47 Oct 16, 2002 [[User:Jheijmans|Jheijmans]] deleted "Unified field theory" <em>(empty, prev \"asdf\")</em> |
|||
#06:46 Oct 16, 2002 [[User:Jheijmans|Jheijmans]] deleted "Other LZ compression methods" <em>(\"u can u see u hepl\")</em> |
|||
#06:46 Oct 16, 2002 [[User:Jheijmans|Jheijmans]] deleted "Bizarro" <em>(empty, prev \"Put your text for the new page here. hjkhjkhj\")</em> |
|||
#06:46 Oct 16, 2002 [[User:Jheijmans|Jheijmans]] deleted "Ear piercing" <em>(empty, prev \"Put your text for the new page here. trtrtrtrtrtrtr\")</em> |
|||
#05:59 Oct 16, 2002 [[User:Sjc|Sjc]] deleted "Flying Wedge" <em>(Another joke: this is about ATMs and has nothing to do with the famous All Black Flying Wedge)</em> |
|||
#05:57 Oct 16, 2002 [[User:Sjc|Sjc]] deleted "AEW" <em>(A joke page: not even remotely worthy of redemption)</em> |
|||
#02:47 Oct 16, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Homeric Hymns" <em>(garbage by 66.69.208.90: \"what did he want\")</em> |
|||
#02:46 Oct 16, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Pisistratos" <em>(garbage by 66.69.208.90: \"Haha if your reading this you suck :P\")</em> |
|||
#01:19 Oct 16, 2002 [[User:Maveric149|Maveric149]] deleted "Sweet Home Alabama (movie)" <em>(t was good!!!!!!!!!!!!!!!!!!!! )</em> |
|||
#01:05 Oct 16, 2002 [[User:Maveric149|Maveric149]] deleted "USS Valley" <em>(redirect to non-existant page)</em> |
|||
#00:14 Oct 16, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Jay Warren" <em>(nonsense by 212.253.158.230: \"Put your text for the new page here.www.expage.com/thaumaturgy\")</em> |
|||
#00:12 Oct 16, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Mustique" <em>(non-article by 194.238.50.52: \"Mustique is the most amasing pkace i have evr been to it\'s so fantastic it\'s unreal.\")</em> |
|||
#22:56 Oct 15, 2002 [[User:Maveric149|Maveric149]] deleted "Egg cell" <em>(Put your text for the new page here. )</em> |
|||
#22:53 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "Ciutat Vella" <em>(empty, prev \"Barri del casc antic de barcelona.\")</em> |
|||
#22:49 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "Like nailing jelly to a tree" <em>(orphan from jargon file \"Like nailing jelly to a tree\")</em> |
|||
⚫ | #22:48 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "Like kicking dead whales down the beach" <em>(orphan from jargon file \"Like kicking dead whales down the beach is a phrase used to describe a slow, difficult, and disgusting process. It was first popularized by a famous quote about the difficulty of getting work done under one of IBM\'s mainframe operating systems. \"Well, you could write a C compiler in COBOL, but it would be like kicking dead whales down the beach.\" See also fear and loathing.\")</em> |
||
<li>22:53 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "Ciutat Vella" <em>(empty, prev \"Barri del casc antic de barcelona.\")</em></li> |
|||
#22:16 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "James Batcheller Sumner" <em>(empty, prev \"ok\")</em> |
|||
⚫ | |||
⚫ | |||
#22:06 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "New England boiled dinner" <em>(empty, prev \"fag\")</em> |
|||
#22:06 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "1208 BC" <em>(empty, prev \"Put your text for the new page here. hey babe\")</em> |
|||
#22:06 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "WikiProject Biology" <em>(\"bitch\")</em> |
|||
#22:05 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "Abelian variety" <em>(\"Dude!\")</em> |
|||
#22:05 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "Cassette" <em>(\"STORAGE DEVICES\")</em> |
|||
#22:04 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "DBA" <em>(\"Database Administrator\")</em> |
|||
#22:04 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "Application layer" <em>(\"what is this all about\")</em> |
|||
#22:04 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "Vacation" <em>(\"Time off work. A holiday.\")</em> |
|||
#22:04 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "Caledonia" <em>(\"(Latin name for:) Scotland\")</em> |
|||
#22:03 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "Lamp" <em>(\"Lamp. Typically a deskside light source\")</em> |
|||
#22:03 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "Talk:Status" <em>(talk of deleted page)</em> |
|||
#22:03 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "Status" <em>(wikipedia is not a dictionary)</em> |
|||
#22:02 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "Mathematics Magazine" <em>(\"pok\")</em> |
|||
#22:02 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "Rangefinder cameras" <em>(\"hi my name is bob. :)\")</em> |
|||
#22:02 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "Copy protection" <em>(empty, prev \"Put your text for the new page here. go next\")</em> |
|||
#22:02 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "Other LZ compression methods" <em>(empty creation)</em> |
|||
#22:01 Oct 15, 2002 [[User:Maveric149|Maveric149]] deleted "Laccolith" <em>(\"fuck u alll i hate scince \" Apparently you didn\'t care for English class either)</em> |
|||
#19:37 Oct 15, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Microsoft Windows 2.0" <em>(Non-article; only content \"Where i can download Windows 1.0 and windows 2.0 please send me link tapster@wp.pl thx\")</em> |
|||
#18:59 Oct 15, 2002 [[User:Stephen Gilbert|Stephen Gilbert]] deleted "Talk:Put" <em>(article page deleted; no useful content)</em> |
|||
#18:58 Oct 15, 2002 [[User:Stephen Gilbert|Stephen Gilbert]] deleted "SPIHT" <em>(newbie experiment; deletion requested)</em> |
|||
#18:57 Oct 15, 2002 [[User:Stephen Gilbert|Stephen Gilbert]] deleted "Put" <em>(copyright violation; requested deletion)</em> |
|||
#18:57 Oct 15, 2002 [[User:Stephen Gilbert|Stephen Gilbert]] deleted "Marcel Petiot" <em>(copyright violation; requested deletion)</em> |
|||
#18:57 Oct 15, 2002 [[User:Stephen Gilbert|Stephen Gilbert]] deleted "WSDL" <em>(copyright violation; requested deletion)</em> |
|||
#18:28 Oct 15, 2002 [[User:Magnus Manske|Magnus Manske]] deleted "Ländervorwahlen/nachNummern" <em>(Says \"0041 Switzerland 0049 Germany\")</em> |
|||
#18:26 Oct 15, 2002 [[User:Tarquin|Tarquin]] deleted "User:ZxAnPhOrIaN/StateReportSites" <em>(by request of user)</em> |
|||
#18:00 Oct 15, 2002 [[User:Scipius|Scipius]] deleted "Jean Renoir" <em>(Full text: \"bum\")</em> |
|||
#14:48 Oct 15, 2002 [[User:Tarquin|Tarquin]] deleted "Cretinous" <em>(more jargon file stuff. not a fictionary, etc)</em> |
|||
#14:44 Oct 15, 2002 [[User:Tarquin|Tarquin]] deleted "Brain-damaged" <em>(please could we stop importing dross from the jargon file?)</em> |
|||
#13:10 Oct 15, 2002 [[User:Tarquin|Tarquin]] deleted "Calculus/chain rule" <em>(fixed links to this page. The full article is at [[Chain rule]])</em> |
|||
#12:29 Oct 15, 2002 [[User:Tarquin|Tarquin]] deleted "Prime number/Talk" <em>(just junk)</em> |
|||
#10:16 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "Slovenia/Temp" <em>(temporary page)</em> |
|||
#06:42 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "USS Lake" <em>(\"The correct name of this ship is USS Lake Champlain.\")</em> |
|||
#06:41 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "USS Philippine" <em>(\"The correct name of this ship is USS Philippine Sea.\")</em> |
|||
#06:41 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "USS Bunker" <em>(\"The correct name of this ship is USS Bunker Hill.\")</em> |
|||
#06:40 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "USS San" <em>(\"The correct name of this ship is USS San Jacinto.\")</em> |
|||
#06:40 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "USS Leyte" <em>(\"The correct name of this ship is USS Leyte Gulf.\")</em> |
|||
#06:40 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "USS Coral" <em>(\"The correct name of this ship is USS Coral Sea\")</em> |
|||
#06:40 Oct 15, 2002 [[User:Jheijmans|Jheijmans]] deleted "USS Belleau" <em>(\"Correct name of this ship is USS Belleau Wood\")</em> |
|||
#06:09 Oct 15, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "USS Franklin" <em>(blank)</em> |
|||
#02:02 Oct 15, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Brown Deer, Wisconsin" <em>(garbage)</em> |
|||
#02:01 Oct 15, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "4004 BC" <em>(irrelevant url)</em> |
|||
#02:01 Oct 15, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Jacques Cossette-Trudel" <em>(swearing in french)</em> |
|||
#02:00 Oct 15, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "University of Wisconsin, Stout" <em>(irrelevancy)</em> |
|||
#01:59 Oct 15, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Jangyn Bridge" <em>(\'hi\')</em> |
|||
#01:59 Oct 15, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Poissy" <em>(blank)</em> |
|||
#01:59 Oct 15, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Talk:Poissy" <em>(irrelevant & article is being deleted (1 sentence only))</em> |
|||
#01:58 Oct 15, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Xerox 1108" <em>(experiment)</em> |
|||
#01:57 Oct 15, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Data vector" <em>(totally irrelevant paragraph)</em> |
|||
#01:55 Oct 15, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Danville, Kentucky" <em>(obscenity)</em> |
|||
#22:15 Oct 14, 2002 [[User:Jheijmans|Jheijmans]] deleted "Bosnian language" <em>(empty, previously \"thank you \")</em> |
|||
#21:57 Oct 14, 2002 [[User:Scipius|Scipius]] deleted "Electric battery" <em>(Full text: \"I like turtles. They are round. \" Indeed.)</em> |
|||
#21:44 Oct 14, 2002 [[User:Scipius|Scipius]] deleted "Talk:Germany/Temp" <em>(/Temp page no longer necessary)</em> |
|||
#21:43 Oct 14, 2002 [[User:Scipius|Scipius]] deleted "Germany/Temp" <em>(/Temp page no longer necessary)</em> |
|||
#21:13 Oct 14, 2002 [[User:Jheijmans|Jheijmans]] deleted "Erasmus" <em>(needed for move, no history but \"conversion script\")</em> |
|||
#21:00 Oct 14, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "General Federation of Jewish Labour" <em>(newbie experiment by 12.236.210.167: only content \"Oh\")</em> |
|||
#16:35 Oct 14, 2002 [[User:Jheijmans|Jheijmans]] deleted "Liudolf of Swabia" <em>(only genealogical information (\"Eldest son of Otto I the Great and his first wife, Eadgyth.\"), orphan (only linked from talk page))</em> |
|||
#16:33 Oct 14, 2002 [[User:Jheijmans|Jheijmans]] deleted "Quay" <em>(Wikipedia is not a dictionary)</em> |
|||
#16:30 Oct 14, 2002 [[User:Jheijmans|Jheijmans]] deleted "Emma Bunton" <em>(empty, previous two types of vandalism, last \"jander jander jander\")</em> |
|||
#16:30 Oct 14, 2002 [[User:Jheijmans|Jheijmans]] deleted "Pavel Chekov" <em>(empty, prev \"He is shite\")</em> |
|||
#12:26 Oct 14, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "TWA 847 hijacking" <em>(Only content \"cool terrorist actions. 88\"; no history; by known vandal 24.201.235.57)</em> |
|||
#11:58 Oct 14, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "U.S. presidential election, 2012" <em>(too far in the future to say anything)</em> |
|||
#09:31 Oct 14, 2002 [[User:Maveric149|Maveric149]] deleted "Route inspection problem" <em>(Put your text for the new page here. gdgdfgdfgdfgdfgd )</em> |
|||
#08:55 Oct 14, 2002 [[User:Maveric149|Maveric149]] deleted "Popper" <em>(junk; moved to bad jokes)</em> |
|||
#07:56 Oct 14, 2002 [[User:Magnus Manske|Magnus Manske]] deleted "Henk Rogers" <em>(Says \"A person.\")</em> |
|||
#07:49 Oct 14, 2002 [[User:Jheijmans|Jheijmans]] deleted "Ani Yuntikwalaski" <em>(copyright violation, been on votes for deletion for a while)</em> |
|||
#07:48 Oct 14, 2002 [[User:Jheijmans|Jheijmans]] deleted "Zulch, Evan" <em>(redirect to deleted page)</em> |
|||
#07:48 Oct 14, 2002 [[User:Jheijmans|Jheijmans]] deleted "Evan Zulch" <em>(empty page)</em> |
|||
#07:46 Oct 14, 2002 [[User:Jheijmans|Jheijmans]] deleted "Sandra Dempsey" <em>(\"Put your text for the new page here.\")</em> |
|||
#07:45 Oct 14, 2002 [[User:Jheijmans|Jheijmans]] deleted "Cassiodorus" <em>(\"Put your text for the new page here. id questions for the history class\")</em> |
|||
#07:45 Oct 14, 2002 [[User:Jheijmans|Jheijmans]] deleted "Daniel Vettori" <em>(\"Put your text for the new page here. yes yes yes\")</em> |
|||
#07:44 Oct 14, 2002 [[User:Jheijmans|Jheijmans]] deleted "El Lissitzky" <em>(\"he was a great man\")</em> |
|||
#07:44 Oct 14, 2002 [[User:Jheijmans|Jheijmans]] deleted "Text to speech" <em>(\"New Text\")</em> |
|||
#07:44 Oct 14, 2002 [[User:Jheijmans|Jheijmans]] deleted "Natural language generation" <em>(\"New Text\")</em> |
|||
#07:44 Oct 14, 2002 [[User:Jheijmans|Jheijmans]] deleted "Program transformation" <em>(\"Test?\")</em> |
|||
#06:27 Oct 14, 2002 [[User:Sjc|Sjc]] deleted "Maclyn McCarty" <em>(Non-page: contained only the statement: \"A nice guy^_^\")</em> |
|||
#04:24 Oct 14, 2002 [[User:Maveric149|Maveric149]] deleted "2109" <em>(Hi every body )</em> |
|||
#03:37 Oct 14, 2002 [[User:Maveric149|Maveric149]] deleted "Phosphorus/Temp" <em>(temp page that is no longer needed)</em> |
|||
#01:03 Oct 14, 2002 [[User:Maveric149|Maveric149]] deleted "Law of Octaves" <em>(kjhjhjh )</em> |
|||
#00:56 Oct 14, 2002 [[User:Maveric149|Maveric149]] deleted "André Malraux" <em>(need to get this out of the way for a correct move)</em> |
|||
#22:53 Oct 13, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Rockefeller Institute" <em>(useless entry by 63.199.203.105: \"A very good school.\")</em> |
|||
#22:52 Oct 13, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Acrostic puzzle" <em>(Newbie experiment by 65.29.135.209. uepnco)</em> |
|||
#22:50 Oct 13, 2002 [[User:Tarquin|Tarquin]] deleted "Raymon Smullyan" <em>(typo)</em> |
|||
#21:19 Oct 13, 2002 [[User:Bryan Derksen|Bryan Derksen]] deleted "Great Red Spot" <em>(Making room for a move. This is a redirect with no history.)</em> |
|||
#21:14 Oct 13, 2002 [[User:Maveric149|Maveric149]] deleted "Superscript" <em>(Wikipedia is not a dictionary)</em> |
|||
#21:13 Oct 13, 2002 [[User:Maveric149|Maveric149]] deleted "Natural order" <em>(Wikipedia is not a dictionary)</em> |
|||
#21:08 Oct 13, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Confused Deputy Problem" <em>(talk page to deleted page)</em> |
|||
#21:01 Oct 13, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Common Earth Language" <em>(talk page to deleted page)</em> |
|||
#20:58 Oct 13, 2002 [[User:Andre Engels|Andre Engels]] deleted "Xerox Document Company" <em>(\"Put your text for the new page here. hgia\")</em> |
|||
#20:58 Oct 13, 2002 [[User:Andre Engels|Andre Engels]] deleted "Nuclear pile" <em>(\"whatevefr\")</em> |
|||
#17:31 Oct 13, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Cheddite" <em>(nonsense by 212.7.9.35; only text \"Put your text for the new page here.ch2)3n2*hclo4)2 8 km/sec.\")</em> |
|||
#12:25 Oct 13, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Supercharger" <em>(nonsense by 62.253.96.5; only contents \"Willy willy willy\")</em> |
|||
#10:32 Oct 13, 2002 [[User:Sjc|Sjc]] deleted "Holt, England" <em>(There are a number of Holts in England in different counties)</em> |
|||
#10:24 Oct 13, 2002 [[User:Jheijmans|Jheijmans]] deleted "Loaded terminology" <em>(dictionary definition)</em> |
|||
#09:49 Oct 13, 2002 [[User:Scipius|Scipius]] deleted "Quercus robur- Ongoing projects & To Do list..." <em>(Deletion of a user\'s to do list that has been moved into user space)</em> |
|||
#07:46 Oct 13, 2002 [[User:Sjc|Sjc]] deleted "October 12 2002 car bomb, Kuta, Bali" <em>(Date of event incorrect: new page similarly entitled at 11/10/2002)</em> |
|||
#07:04 Oct 13, 2002 [[User:Maveric149|Maveric149]] deleted "Latin phrases" <em>(need to get this out of the way for a correct move)</em> |
|||
#02:14 Oct 13, 2002 [[User:Maveric149|Maveric149]] deleted "American Christian Zionists" <em>(Referring to a politically Zionist agenda of American Christian Fundamentalists. ; Wikipedia is not a dictionary and this term appears to be ideosyncratic)</em> |
|||
#23:34 Oct 12, 2002 [[User:Scipius|Scipius]] deleted "Curly Howard" <em>(Full text: \"nyuk \")</em> |
|||
⚫ | |||
<li>02:14 Oct 13, 2002 [[User:Maveric149|Maveric149]] deleted "American Christian Zionists" <em>(Referring to a politically Zionist agenda of American Christian Fundamentalists. ; Wikipedia is not a dictionary and this term appears to be ideosyncratic)</em></li> |
|||
#21:41 Oct 12, 2002 [[User:Magnus Manske|Magnus Manske]] deleted "Redirect test page A" <em>(REDIRECT Redirect test page B)</em> |
|||
#21:41 Oct 12, 2002 [[User:Magnus Manske|Magnus Manske]] deleted "Redirect test page C" <em>(REDIRECT Redirect test page A)</em> |
|||
#21:41 Oct 12, 2002 [[User:Magnus Manske|Magnus Manske]] deleted "Redirect test page B" <em>(REDIRECT Redirect test page C)</em> |
|||
#21:12 Oct 12, 2002 [[User:Tarquin|Tarquin]] deleted "Talk:The simpsons/dr. nick riviera" <em>(wrong page title -- doesnt match the real article and empty)</em> |
|||
#20:37 Oct 12, 2002 [[User:Jheijmans|Jheijmans]] deleted "Kent Keith" <em>(\"http://www.paradoxicalcommandments.com/\")</em> |
|||
#20:35 Oct 12, 2002 [[User:Jheijmans|Jheijmans]] deleted "FrameMaker" <em>(empty, prev \"ut your text for the new page here. This paper seeks to assess the effectiveness of a popular grammar and style checker, Grammatik V, (etc.)\")</em> |
|||
#16:35 Oct 12, 2002 [[User:Andre Engels|Andre Engels]] deleted "Robert Guiscard" <em>(copyright violation; from votes for deletion)</em> |
|||
#15:59 Oct 12, 2002 [[User:Andre Engels|Andre Engels]] deleted "SoHo, New York City, New York" <em>(recently created orphan; deletion requested by originator)</em> |
|||
<li>20:35 Oct 12, 2002 [[User:Jheijmans|Jheijmans]] deleted "FrameMaker" <em>(empty, prev \"ut your text for the new page here. This paper seeks to assess the effectiveness of a popular grammar and style checker, Grammatik V, (etc.)\")</em></li> |
|||
#15:59 Oct 12, 2002 [[User:Andre Engels|Andre Engels]] deleted "Murray Hill, New York City, New York" <em>(recently created orphan; deletion requested by originator)</em> |
|||
#15:58 Oct 12, 2002 [[User:Andre Engels|Andre Engels]] deleted "Harlem, New York City, New York" <em>(orphan; deletion requested by originator)</em> |
|||
#15:58 Oct 12, 2002 [[User:Andre Engels|Andre Engels]] deleted "Greenwich Village, New York City, New York" <em>(orphan; deletion requested by originator)</em> |
|||
#15:32 Oct 12, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "List of famous people who had sex with animals" <em>(Page by 213.122.219.144, previously deleted.)</em> |
|||
#14:36 Oct 12, 2002 [[User:Tarquin|Tarquin]] deleted "ZxAnPhOrIaN/StateReportSites" <em>(moved to user space)</em> |
|||
#13:09 Oct 12, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Charles Cunningham Boycott" <em>(garbage by 64.105.22.115: \"he was boned in 1832, and choked to death on a sandwhich in 1897.... O NO WAIT\" etc.)</em> |
|||
#12:10 Oct 12, 2002 [[User:Andre Engels|Andre Engels]] deleted "Internet gaming" <em>(useless stub: \"Games played on or with the aid of internet communications.\")</em> |
|||
#12:09 Oct 12, 2002 [[User:Andre Engels|Andre Engels]] deleted "Joe Rock" <em>(\"hey so you like... stuff\")</em> |
|||
#12:08 Oct 12, 2002 [[User:Andre Engels|Andre Engels]] deleted "Herman Brusselmans" <em>(empty page, previously \"Ne Klootzak die alleen maar vuilspuiterij kan schrijven over beffen en kakken\" (which is some Dutch insult to the person the page should be about))</em> |
|||
#12:08 Oct 12, 2002 [[User:Andre Engels|Andre Engels]] deleted "Queen Anne's War" <em>(empty page, previous text \"HEY WHATS UP EVERYONE, IF U WANT INFO, U WONT FIND ITHERE HAHAHAH\")</em> |
|||
⚫ | |||
<li>12:08 Oct 12, 2002 [[User:Andre Engels|Andre Engels]] deleted "Herman Brusselmans" <em>(empty page, previously \"Ne Klootzak die alleen maar vuilspuiterij kan schrijven over beffen en kakken\" (which is some Dutch insult to the person the page should be about))</em></li> |
|||
#03:36 Oct 12, 2002 [[User:Maveric149|Maveric149]] deleted "Wikipedia:Naming conventions (city names)" <em>(need to get this out of the way for a move-back)</em> |
|||
#03:35 Oct 12, 2002 [[User:Maveric149|Maveric149]] deleted "Wikipedia:Naming conventions (ships)" <em>(need to get this out of the way for a move-back)</em> |
|||
#03:34 Oct 12, 2002 [[User:Maveric149|Maveric149]] deleted "Wikipedia:Naming conventions (movies)" <em>(need to get this out of the way for a move-back)</em> |
|||
#03:34 Oct 12, 2002 [[User:Maveric149|Maveric149]] deleted "Wikipedia:Naming conventions (names and titles)" <em>(need to get this out of the way for a move-back)</em> |
|||
#03:33 Oct 12, 2002 [[User:Maveric149|Maveric149]] deleted "Wikipedia:Naming conventions (precision)" <em>(need to get this out of the way for a move-back)</em> |
|||
#03:32 Oct 12, 2002 [[User:Maveric149|Maveric149]] deleted "Wikipedia:Naming conventions (common names)" <em>(need to get this out of the way for a move-back)</em> |
|||
#03:32 Oct 12, 2002 [[User:Maveric149|Maveric149]] deleted "Wikipedia:Naming conventions (anglicization)" <em>(need to get this out of the way for a move-back)</em> |
|||
#03:31 Oct 12, 2002 [[User:Maveric149|Maveric149]] deleted "Wikipedia:Naming conventions (pluralization)" <em>(need to get this out of the way for a move-back)</em> |
|||
#03:30 Oct 12, 2002 [[User:Maveric149|Maveric149]] deleted "Wikipedia:Naming conventions (capitalization)" <em>(need to get this out of the way for a move-back)</em> |
|||
#03:28 Oct 12, 2002 [[User:Maveric149|Maveric149]] deleted "Wikipedia:Naming conventions (acronyms)" <em>(need to get this out of the way for a move-back)</em> |
|||
#02:25 Oct 12, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "VMWare" <em>(vandalism)</em> |
|||
#02:24 Oct 12, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "List of famous people who had sex with animals" <em>(i seriously doubt we need this page! )</em> |
|||
#00:27 Oct 12, 2002 [[User:Tarquin|Tarquin]] deleted "HfTupper" <em>(mysterious empty orphan with no history)</em> |
|||
#23:47 Oct 11, 2002 [[User:Andre Engels|Andre Engels]] deleted "List of collective nouns by collective terms" <em>(mis-move, moved on to Talk:List_of_collective_nouns_by_collective_term)</em> |
|||
#23:44 Oct 11, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:ColdWar" <em>(empty; old contents only the (unanswered) question how pages are moved)</em> |
|||
#23:03 Oct 11, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Chinese characteristics" <em>(\"Put your text for the new page here. Gentle Bear\")</em> |
|||
#22:58 Oct 11, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Queen (Chess)" <em>(mis-move, page should have gone to Talk:Queen (chess) (and is there now))</em> |
|||
#22:49 Oct 11, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Ǭç¹è§è§£" <em>(talk page of deleted page)</em> |
|||
#22:38 Oct 11, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Candy blunt" <em>(talk to deleted page)</em> |
|||
#22:33 Oct 11, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Business and Industry basic topics" <em>(empty page, only history \"Describe the new page here\")</em> |
|||
#22:28 Oct 11, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Bubi" <em>(talk page of deleted page)</em> |
|||
#22:26 Oct 11, 2002 [[User:Scipius|Scipius]] deleted "Mossel Bay" <em>(Full text: \"Put your text for the new page here.about the of bartolamev dias \")</em> |
|||
#22:25 Oct 11, 2002 [[User:Scipius|Scipius]] deleted "Georges Pompidou" <em>(Full text: \"ÒÓÓÓÓÓÓÓÓÓÓ!!!!!!!!!!11 ÏÐÈÂÅÒÈÊÈ ÈÇ ÁÅËÀÐÓÑÈ!!!!!!!!!!!! BELARUS!!!!!!!!!!!!!!!!!!!!1 \")</em> |
|||
#22:24 Oct 11, 2002 [[User:Scipius|Scipius]] deleted "Carboxyl group" <em>(Full text: \"carboxyl\")</em> |
|||
#22:20 Oct 11, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Bridge game" <em>(only text \"see Talk:Contract bridge for a suggestion on moving this page -- Tarquin\" - outdated, since the move has already taken place)</em> |
|||
<li>22:25 Oct 11, 2002 [[User:Scipius|Scipius]] deleted "Georges Pompidou" <em>(Full text: \"ÒÓÓÓÓÓÓÓÓÓÓ!!!!!!!!!!11 ÏÐÈÂÅÒÈÊÈ ÈÇ ÁÅËÀÐÓÑÈ!!!!!!!!!!!! BELARUS!!!!!!!!!!!!!!!!!!!!1 \")</em></li> |
|||
#22:17 Oct 11, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Boure" <em>(talk page to deleted page)</em> |
|||
#22:16 Oct 11, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Boris the crazy Russian" <em>(talk page to deleted page)</em> |
|||
#22:08 Oct 11, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Blue-green money" <em>(talk of deleted page)</em> |
|||
#22:00 Oct 11, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Bilbo" <em>(\"Why doesn\'t the redirect work? And shouldn\'t the article be entitled Bilbo rather than using the slash?\" - the redirect works, and there is no slash to be found anywhere)</em> |
|||
#21:49 Oct 11, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Belief in God spectrum" <em>(talk page without subject page; contents are already on meta)</em> |
|||
#21:41 Oct 11, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Battle of TannenburgBattle of Grunwald" <em>(talk of deleted page, only saying where it should be redirected)</em> |
|||
#21:34 Oct 11, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Baptism of the dead" <em>(talk page to deleted page)</em> |
|||
#21:33 Oct 11, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Bantu languages" <em>(only text \"The text from Bantu should be moved here\" (which happened ages ago); making place for a move of Talk:Bantu)</em> |
|||
#21:30 Oct 11, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Baker Natalie Bachrach" <em>(talk page without subject page)</em> |
|||
#18:29 Oct 11, 2002 [[User:Ed Poor|Ed Poor]] deleted "Talk:List of famous people who have pierced their private parts" <em>(Requested by Easter Bradford)</em> |
|||
#17:50 Oct 11, 2002 [[User:Jheijmans|Jheijmans]] deleted "Victoria, Seychelles" <em>(\"yyyyyyyyyyyyyyyyyyyyyy\")</em> |
|||
#11:54 Oct 11, 2002 [[User:Andre Engels|Andre Engels]] deleted "Nika revolt" <em>(copyright violation; on votes for deletion for over a week)</em> |
|||
#11:50 Oct 11, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Togidubnus" <em>(212.23.26.209 claims to have been Togidubnus in a past life)</em> |
|||
#11:15 Oct 11, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Antonella Brugnola" <em>(unneeded double redirect)</em> |
|||
#07:21 Oct 11, 2002 [[User:Jheijmans|Jheijmans]] deleted "Siobhan Fahey" <em>(\"The offical siobhan fahey website can be found at: http://www.siobhanfahey.com/\")</em> |
|||
#07:21 Oct 11, 2002 [[User:Jheijmans|Jheijmans]] deleted "Augusta of Saxe-Gotha" <em>(\"hey y\'all, i\'m from texas, can\'t y\'all tell? good luck with your research on Augusta of Saxe-Gotha. Now, did y\'all really expect 2 find some information on this old lady from an old texan? now i didn\'t think so!bye, luv y\'all!\")</em> |
|||
<li>11:15 Oct 11, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Antonella Brugnola" <em>(unneeded double redirect)</em></li> |
|||
#07:20 Oct 11, 2002 [[User:Jheijmans|Jheijmans]] deleted "Governor-General's Award for Creative Non-Fiction" <em>(\"famous people the mccaughan\'s family Brad McCaughan Carolyn McCaughan Samantha McCaughan Gregory McCaughan Timothy McCaughan Tappy McCaughan\")</em> |
|||
#07:19 Oct 11, 2002 [[User:Jheijmans|Jheijmans]] deleted "War of the Grand Alliance" <em>(\"considering the fact that spain sucks, i will not write anything about this subject! GO...\")</em> |
|||
#07:19 Oct 11, 2002 [[User:Jheijmans|Jheijmans]] deleted "William Pitt, the Younger" <em>(\"Hi people, its bill bob joe! i luv u all!! hugs and kisses!! hope u like my page bout william pitt, the younger! hope it helps with your report!!! luv ya all\")</em> |
|||
#06:50 Oct 11, 2002 [[User:Jheijmans|Jheijmans]] deleted "Partido dos Trabalhadores" <em>(\"PT is a left Brazilian party.\")</em> |
|||
#06:49 Oct 11, 2002 [[User:Jheijmans|Jheijmans]] deleted "Amazonia" <em>(\"Amazonia Florest is Brazilian!!!!!!!\")</em> |
|||
#06:49 Oct 11, 2002 [[User:Jheijmans|Jheijmans]] deleted "Fred Olsen" <em>(\"http://www.fredolsen.es/lineas/english/index.htm\")</em> |
|||
#06:48 Oct 11, 2002 [[User:Jheijmans|Jheijmans]] deleted "Talk:Autodynamics" <em>(talk page of removed page)</em> |
|||
#06:48 Oct 11, 2002 [[User:Jheijmans|Jheijmans]] deleted "Autodynamics" <em>(former nonsense/poss. copyright violation)</em> |
|||
#06:47 Oct 11, 2002 [[User:Jheijmans|Jheijmans]] deleted "DNA computer" <em>(emptied by original author)</em> |
|||
#06:46 Oct 11, 2002 [[User:Jheijmans|Jheijmans]] deleted "Matthew Lancelot Ryan" <em>(emptied by Zoe)</em> |
|||
#05:34 Oct 11, 2002 [[User:Maveric149|Maveric149]] deleted "Eternity" <em>(joke; Eternity Definition: It is the moment between you come and the moment you can go home! )</em> |
|||
#01:49 Oct 11, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Toba" <em>(khdjlkfhaslkf: Toba pagandi.)</em> |
|||
#01:44 Oct 11, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Blah" <em>(newbie playing in sandbox)</em> |
|||
#01:00 Oct 11, 2002 [[User:Maveric149|Maveric149]] deleted "Macintosh raincoat" <em>(blank; junk in history)</em> |
|||
#20:49 Oct 10, 2002 [[User:Scipius|Scipius]] deleted "Cafe wall illusion" <em>(Full text: \"CLUB LIQUID\")</em> |
|||
#20:15 Oct 10, 2002 [[User:Tarquin|Tarquin]] deleted "Line segment" <em>(just junk)</em> |
|||
#20:15 Oct 10, 2002 [[User:Tarquin|Tarquin]] deleted "Pembrokeshire" <em>(just junk)</em> |
|||
#20:15 Oct 10, 2002 [[User:Tarquin|Tarquin]] deleted "Channel coding" <em>(just junk)</em> |
|||
#18:07 Oct 10, 2002 [[User:Scipius|Scipius]] deleted "Image:Uk flag largeupsidedown.png" <em>(Flag no longer necessary)</em> |
|||
#18:04 Oct 10, 2002 [[User:Scipius|Scipius]] deleted "Image:Waveflag.gif" <em>(Again removed superfluous US flag)</em> |
|||
#16:11 Oct 10, 2002 [[User:Scipius|Scipius]] deleted "Nixon" <em>(Full text: \"Put your text for the new page here. crook\" (not redirected because the movie might use it))</em> |
|||
#12:19 Oct 10, 2002 [[User:Jheijmans|Jheijmans]] deleted "Shooting at the 1936 Summer Olympics" <em>(\"hi i amin the 9th grade doin homework for heritage 9\")</em> |
|||
#12:08 Oct 10, 2002 [[User:Karen Johnson|Karen Johnson]] deleted "Shar" <em>(nonentry)</em> |
|||
#09:28 Oct 10, 2002 [[User:Jheijmans|Jheijmans]] deleted "Palette" <em>(\"Put your text for the new page here.SADSDSSSS\")</em> |
|||
#09:27 Oct 10, 2002 [[User:Jheijmans|Jheijmans]] deleted "Executive department" <em>(\"Put your text for the new page here.\")</em> |
|||
#07:00 Oct 10, 2002 [[User:Maveric149|Maveric149]] deleted "Helium/Temp" <em>(temp page that is no longer needed)</em> |
|||
#06:50 Oct 10, 2002 [[User:Robert Merkel|Robert Merkel]] deleted "Drexel Shaft" <em>(joke page (content added to bad jokes and deleted nonsense))</em> |
|||
#06:49 Oct 10, 2002 [[User:Robert Merkel|Robert Merkel]] deleted "Talk:Drexel Shaft" <em>(deleting parent page)</em> |
|||
#06:46 Oct 10, 2002 [[User:Jheijmans|Jheijmans]] deleted "Robert Moses" <em>(\"Put your text for the new page here.\")</em> |
|||
#06:46 Oct 10, 2002 [[User:Jheijmans|Jheijmans]] deleted "Correspondence course" <em>(\"master in business and administration\")</em> |
|||
#06:44 Oct 10, 2002 [[User:Jheijmans|Jheijmans]] deleted "Discordance Axis" <em>(\"these guys fucking rock\")</em> |
|||
#06:44 Oct 10, 2002 [[User:Jheijmans|Jheijmans]] deleted "Frederick, Lord North" <em>(\"Lord North was a freak!\")</em> |
|||
#06:44 Oct 10, 2002 [[User:Jheijmans|Jheijmans]] deleted "Social Development" <em>(\"This is whack! \")</em> |
|||
#06:43 Oct 10, 2002 [[User:Jheijmans|Jheijmans]] deleted "Obfuscated PostScript Contest" <em>(empty, prev \"blarg\")</em> |
|||
#06:43 Oct 10, 2002 [[User:Jheijmans|Jheijmans]] deleted "Gungan" <em>(empty, prev \"hello my friend my name is Jesse i am talking in wikipedia\")</em> |
|||
#01:19 Oct 10, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Pinworm" <em>(newbie experiment by 63.226.31.222: only contents \"gay!!\")</em> |
|||
#00:26 Oct 10, 2002 [[User:Andre Engels|Andre Engels]] deleted "Zacharias Janssen" <em>(empty page; only former contents: \"dude\")</em> |
|||
#21:43 Oct 9, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Motnitroat" <em>(Orphan article by 217.35.86.218 about a non-word.)</em> |
|||
#20:47 Oct 9, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Contract bridge palying technique" <em>(orphan typo; contents have been moved to correct spelling)</em> |
|||
#19:54 Oct 9, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:50 kroner note" <em>(similar to the 200 kroner note)</em> |
|||
#19:54 Oct 9, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:200 kroner note" <em>(empty, and has been such for 2 1/2 months after only 13 minutes of existence with text)</em> |
|||
#19:48 Oct 9, 2002 [[User:Magnus Manske|Magnus Manske]] deleted "Topory" <em>(Says \"Piotr Parda; Przenies sie do User: namespace, bo beda sobie robic z ciebie jaja, ze chcesz pisac artykul/ o sobie. ;-)\")</em> |
|||
#19:42 Oct 9, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:ATI" <em>(talk of deleted page; only contents is the origin of the (copyright violating) information)</em> |
|||
#19:28 Oct 9, 2002 [[User:Ed Poor|Ed Poor]] deleted "Time base" <em>(graffiti page)</em> |
|||
#19:27 Oct 9, 2002 [[User:Ed Poor|Ed Poor]] deleted "Staff system" <em>(graffiti page)</em> |
|||
#19:27 Oct 9, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Anthocyanins" <em>(Only the contents of the deleted subject page, which was basically an advertisement)</em> |
|||
#19:26 Oct 9, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Anomy" <em>(empty talk page; only history \"This needs to be elaborated on\")</em> |
|||
#19:25 Oct 9, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Angel/far-fetched belief" <em>(talk of deleted page)</em> |
|||
#19:24 Oct 9, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Ancient civilization" <em>(talk about whether \'Celts\' and \'Israel\' are civilizations. Since the article is now redirecting to \'ancient history\', which does not use the term \'civilization\' at all, not of any interest)</em> |
|||
#19:22 Oct 9, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Anarchy Online" <em>(talk of deleted page, just arguing why the page should be deleted)</em> |
|||
#19:20 Oct 9, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:American Union of Men" <em>(talk to deleted page)</em> |
|||
#19:18 Oct 9, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Amead" <em>(Talk to deleted page)</em> |
|||
#19:15 Oct 9, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:A.L.I.C.E" <em>(Empty, has been for a long time)</em> |
|||
#18:57 Oct 9, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Adek336" <em>(talk page without subject page)</em> |
|||
#18:50 Oct 9, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:2002 State of the Union Address" <em>(Talk of a page that is de facto deleted)</em> |
|||
#18:49 Oct 9, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:72 virgins" <em>(talk page to deleted page)</em> |
|||
#18:43 Oct 9, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:23nd century" <em>(Talk page without corresponding subject page)</em> |
|||
#18:39 Oct 9, 2002 [[User:Andre Engels|Andre Engels]] deleted "Talk:Antiwikipedic" <em>(moved to meta; subject page has already been deleted)</em> |
|||
#18:33 Oct 9, 2002 [[User:Andre Engels|Andre Engels]] deleted "Painting techniques" <em>(Just the beginning of \'Impressionism\' copied (even with the \'redirected from Impressionist\' in it))</em> |
|||
#18:32 Oct 9, 2002 [[User:Andre Engels|Andre Engels]] deleted "Anna Moffo" <em>(advertisement (for a biography on Anna Moffo))</em> |
|||
#17:49 Oct 9, 2002 [[User:Scipius|Scipius]] deleted "Afar language" <em>(Article talked about how Afar was causing confusion among students of Roosevelt High in Minneapolis. Nothing on the language itself, therefore junk.)</em> |
|||
#17:44 Oct 9, 2002 [[User:Scipius|Scipius]] deleted "Bayer Company" <em>(Full text: poop opium is bad 4 )</em> |
|||
#17:39 Oct 9, 2002 [[User:Scipius|Scipius]] deleted "Ypres" <em>(A bit of a test or something: Full text: Put your text for the new page here. crystal )</em> |
|||
#17:24 Oct 9, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Heian Period" <em>(Junk by 216.231.11.130: \"no i am not goign to write stuff for u to steal\")</em> |
|||
#17:21 Oct 9, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Zhu" <em>(junk by 216.231.11.130: \"Put your text for the new page here. ur gay and so is teh zhu dynasty casue ur not giving me any info!!!!\")</em> |
|||
#17:21 Oct 9, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Zhu" <em>(junk by 216.231.11.130: \"Put your text for the new page here. ur gay and so is teh zhu dynasty casue ur not giving me any info!!!!\")</em> |
|||
#08:09 Oct 9, 2002 [[User:Andre Engels|Andre Engels]] deleted "Cleisthenes" <em>(\"Put your text for the new page here. what does it mean?\")</em> |
|||
#06:34 Oct 9, 2002 [[User:Jheijmans|Jheijmans]] deleted "Mossel Bay" <em>(\"Put your text for the new page here. Me Gay man\")</em> |
|||
#06:34 Oct 9, 2002 [[User:Jheijmans|Jheijmans]] deleted "Clerks" <em>(\"First movie by Kevin Smith.\")</em> |
|||
#06:34 Oct 9, 2002 [[User:Jheijmans|Jheijmans]] deleted "World War II/The Blitz" <em>(\"Help\")</em> |
|||
#06:33 Oct 9, 2002 [[User:Jheijmans|Jheijmans]] deleted "Bridge of Sighs" <em>(empty, prev \"sites\")</em> |
|||
#06:32 Oct 9, 2002 [[User:Maveric149|Maveric149]] deleted "Syntax analysis" <em>(pro )</em> |
|||
#06:07 Oct 9, 2002 [[User:Maveric149|Maveric149]] deleted "Neon/Temp" <em>(temp page that is no longer needed)</em> |
|||
#00:44 Oct 9, 2002 [[User:Maveric149|Maveric149]] deleted "Waxhaw, South Carolina" <em>(Put your text for the new page here. map )</em> |
|||
#22:31 Oct 8, 2002 [[User:Lee Daniel Crocker|Lee Daniel Crocker]] deleted "Natural catastrophe" <em>(Same kid; no content or history in either page.)</em> |
|||
#22:30 Oct 8, 2002 [[User:Lee Daniel Crocker|Lee Daniel Crocker]] deleted "Ignatius Donnelly" <em>(Just a kid playing around...)</em> |
|||
#21:37 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Khamis Mushait" <em>(redirect, needed for move)</em> |
|||
#21:35 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Kleene algebra" <em>(\"AXYZFBD AXYZFCD AXYZXYZFCD AXYZXYZFBD AXYZXYZXYZFBD AXYZXYZXYZFBD AXYZXYZXYZFBD AXYZXYZXYZFBD AXYZXYZFCD AXYZXYZFBD AXYZXYZXYZFCD AXYZXYZXYZFCD AXYZXYZXYZFCD AXYZXYZXYZFCD\")</em> |
|||
<li>22:30 Oct 8, 2002 [[User:Lee Daniel Crocker|Lee Daniel Crocker]] deleted "Ignatius Donnelly" <em>(Just a kid playing around...)</em></li> |
|||
#21:35 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Extranet" <em>(\"Any Idea??\")</em> |
|||
#21:35 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Young Turks" <em>(\"Young Turks.\")</em> |
|||
#21:35 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Motorola 68008" <em>(\"Put your text for the new page here. gngh\")</em> |
|||
#21:34 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Milwaukee Deep" <em>(\"my name is rover mcrover i am in 2nd grade\")</em> |
|||
#21:34 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Polish-Lithuanian Commonwealth" <em>([[History of Poland]])</em> |
|||
#19:17 Oct 8, 2002 [[User:Tarquin|Tarquin]] deleted "Clifford E. Berry" <em>(junk entry)</em> |
|||
#17:30 Oct 8, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Cockermouth" <em>(empty orphan contained junk)</em> |
|||
#15:45 Oct 8, 2002 [[User:Tarquin|Tarquin]] deleted "Hiawatha" <em>(no content)</em> |
|||
#15:44 Oct 8, 2002 [[User:Tarquin|Tarquin]] deleted "Mazurka" <em>(no content)</em> |
|||
#10:46 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Provisional Government" <em>(empty, prev \"Gör som jag säger annars skruvar jag fast dig i bordet.\" /Jorma Hogeborn\")</em> |
|||
#10:37 Oct 8, 2002 [[User:Andre Engels|Andre Engels]] deleted "Internet humor/Two Cows Talk" <em>(Talk page hiding as a subpage; contents have been moved to Talk:You have two cows)</em> |
|||
#10:36 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Romania/Temp" <em>(temporary page)</em> |
|||
#10:34 Oct 8, 2002 [[User:Andre Engels|Andre Engels]] deleted "Beloit College" <em>(copyright violation; has been on Votes for deletion for a week; already taken off \'Votes for Deletion\' as an already deleted page)</em> |
|||
#10:31 Oct 8, 2002 [[User:Andre Engels|Andre Engels]] deleted "New York City, New York/Murray Hill" <em>(short-lived page, now only orphan redirect, deletion requested by originator)</em> |
|||
#10:30 Oct 8, 2002 [[User:Andre Engels|Andre Engels]] deleted "New York City, New York/Harlem" <em>(short-lived page, now only redirect, deletion requested by originator)</em> |
|||
#08:56 Oct 8, 2002 [[User:WojPob|WojPob]] deleted "Motorola Coldfire" <em>(non article, no history)</em> |
|||
#08:33 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "List of Biblical names starting with W" <em>(\"There are no names in the Bible that start with W.\")</em> |
|||
#08:32 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "List of Biblical names starting with X" <em>(\"There are no names in the Bible that start with X\")</em> |
|||
#08:31 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Sympathomimetic" <em>(\"Put your text for the new page here.theobromine\")</em> |
|||
#08:28 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Talk:OsmosisTwo" <em>(talk page of removed page)</em> |
|||
#08:28 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "OsmosisTwo" <em>(nonsense page, listed on votes for deletion for some time)</em> |
|||
#08:27 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Protea" <em>(copyright violation, been on votes for deletion for some time)</em> |
|||
#08:26 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Teunis de Wit" <em>(personal page, listed on votes for deletion for some time)</em> |
|||
#08:26 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Talk:John T. Thompson" <em>(talk page of removed page)</em> |
|||
#08:26 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "John T. Thompson" <em>(copyright violation, been on votes for deletion for some time)</em> |
|||
#08:25 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Talk:Kaspar Schlick" <em>(talk page of removed page)</em> |
|||
#08:25 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Kaspar Schlick" <em>(copyright violation (in German), been on votes for deletion for some time)</em> |
|||
#07:45 Oct 8, 2002 [[User:Maveric149|Maveric149]] deleted "Manned space mission" <em>(content moved. Getting this out of the way for a correct move)</em> |
|||
#06:53 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Lost Jerusalem" <em>(redirect, needed for move)</em> |
|||
#06:52 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Eldridge" <em>(redirect, needed for move)</em> |
|||
#06:52 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Neo Jerusalem" <em>(redirect, needed for move)</em> |
|||
#06:51 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Aveh" <em>(redirect, needed for move)</em> |
|||
#06:40 Oct 8, 2002 [[User:Maveric149|Maveric149]] deleted "Rubber tire" <em>(blank; junk in history)</em> |
|||
#06:40 Oct 8, 2002 [[User:WojPob|WojPob]] deleted "APHMEC" <em>(a non-article, requested)</em> |
|||
#06:34 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Teddy Flack" <em>(\"Put your text for the new page here.i want a picture of teddy flack \")</em> |
|||
#06:33 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Non-zero-sum games" <em>(\"An example of a non-zero sum game would be the classic Bean game\")</em> |
|||
#06:32 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Description" <em>(\"Description: words used to demonstrate the attributes of\")</em> |
|||
#06:25 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Meet in the middle" <em>(\"Put your text for the new page here. Haha..\")</em> |
|||
#06:25 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Miniscule" <em>(\"really small, insignificant, neglible\" (should be min_u_scule, anyway))</em> |
|||
#06:24 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Joseph-Marie Jacquard" <em>(\"he smelled like a pig donkey buttmunch.\")</em> |
|||
#06:23 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "William Bradford" <em>(\"Put your text for the new page he\")</em> |
|||
#06:23 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Hokkien" <em>(\"Beautiful Country \")</em> |
|||
#06:23 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Fad" <em>(empty, prev \"Main Entry: fad Pronunciation: \'fad Function: noun Etymology: origin unknown Date: 1867 (etc.)\")</em> |
|||
#06:22 Oct 8, 2002 [[User:Jheijmans|Jheijmans]] deleted "Dahab, Egypt" <em>(empty, prev \"www.daniela-hotels.com\")</em> |
|||
#05:45 Oct 8, 2002 [[User:Maveric149|Maveric149]] deleted "Argon/Temp" <em>(temp page that is no longer needed)</em> |
|||
#03:18 Oct 8, 2002 [[User:Maveric149|Maveric149]] deleted "Kristin Otto" <em>(go to http://www.www.com !!!!its a search engine no that doesnt have anything to do with kristin otto but WHO CARE? hahahahahahahahahahahahahaha )</em> |
|||
#02:18 Oct 8, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Hadrian's Wall" <em>(Cut-n-paste from [[Hadrian\'s wall]]; no editing done under this capitalization. Content moved back there, need to delete this one to free up the title for renaming.)</em> |
|||
#01:20 Oct 8, 2002 [[User:Maveric149|Maveric149]] deleted "Jian" <em>(blank; junk in history)</em> |
|||
#01:18 Oct 8, 2002 [[User:Maveric149|Maveric149]] deleted "Cape Town" <em>(just a redirect; no history; need to get this out of the way for a move)</em> |
|||
#00:10 Oct 8, 2002 [[User:Andre Engels|Andre Engels]] deleted "Berger Roy Al" <em>(copyright violation; has been on votes for deletion for a week)</em> |
|||
#00:08 Oct 8, 2002 [[User:Andre Engels|Andre Engels]] deleted "Anarcosocial-communism" <em>(non-subject, moved to meta, on Votes for Deletion)</em> |
|||
#00:08 Oct 8, 2002 [[User:Andre Engels|Andre Engels]] deleted "Loyda Morales" <em>(No factual information; has been on votes for deletion for 1 week without dissent)</em> |
|||
#00:07 Oct 8, 2002 [[User:Andre Engels|Andre Engels]] deleted "Bonneville Apartments" <em>(looks like an advertisement, has been on Votes for Deletion for 1 week without dissent)</em> |
|||
#23:56 Oct 7, 2002 [[User:Maveric149|Maveric149]] deleted "London College of Fashion" <em>(The London College of Fashion should be listed under The London Institute. )</em> |
|||
#23:44 Oct 7, 2002 [[User:Maveric149|Maveric149]] deleted "Mustard agent" <em>(Put your text for the new page here.jhnikjikml;koklp[iu8uiureua9g8qwtnqertijirGJIRJGIJIAERFDARijijsejixjijijiwejgjgirjegiijijijseXJJJIJGIJIREGIGR )</em> |
|||
<li>00:07 Oct 8, 2002 [[User:Andre Engels|Andre Engels]] deleted "Bonneville Apartments" <em>(looks like an advertisement, has been on Votes for Deletion for 1 week without dissent)</em></li> |
|||
#23:42 Oct 7, 2002 [[User:Maveric149|Maveric149]] deleted "Pacific loon" <em>(http://www.birdphotography.com/ )</em> |
|||
#23:08 Oct 7, 2002 [[User:Maveric149|Maveric149]] deleted "Party congress of the CPSU" <em>(junk; hey guess what im copyrited and you aren tonitng )</em> |
|||
#23:03 Oct 7, 2002 [[User:Maveric149|Maveric149]] deleted "Law of Canada" <em>(junk; Put your text for the new page here. history of canadian criminal law )</em> |
|||
#22:14 Oct 7, 2002 [[User:Lee Daniel Crocker|Lee Daniel Crocker]] deleted "WINE" <em>(Preparing for move...)</em> |
|||
#21:34 Oct 7, 2002 [[User:Tarquin|Tarquin]] deleted "Madame Grey" <em>(just daft text)</em> |
|||
#17:51 Oct 7, 2002 [[User:Jheijmans|Jheijmans]] deleted "Luxembourg/Temp" <em>(temporary page)</em> |
|||
#15:04 Oct 7, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "S’Archittu" <em>(Junk by 151.29.72.97. Just weblink. Deleted for at least the second time.)</em> |
|||
#14:22 Oct 7, 2002 [[User:Tarquin|Tarquin]] deleted "Dungeons & Dragons (temp)" <em>(temp page)</em> |
|||
#14:22 Oct 7, 2002 [[User:Tarquin|Tarquin]] deleted "Dungeons & Dragons" <em>(making room for move)</em> |
|||
#14:10 Oct 7, 2002 [[User:Jheijmans|Jheijmans]] deleted "Nagoya" <em>(getting out of the way for move)</em> |
|||
#13:38 Oct 7, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "S’Archittu" <em>(title contains weird character; content is only web links)</em> |
|||
#13:27 Oct 7, 2002 [[User:Jheijmans|Jheijmans]] deleted "Talk:North Brabant/Temp" <em>(talk page of temporary page - contents moved)</em> |
|||
#13:27 Oct 7, 2002 [[User:Jheijmans|Jheijmans]] deleted "North Brabant/Temp" <em>(temporary page)</em> |
|||
#13:24 Oct 7, 2002 [[User:WojPob|WojPob]] deleted "Defence Intelligence Agency" <em>(spelling wrong, I\'m an idiot)</em> |
|||
#11:06 Oct 7, 2002 [[User:Tarquin|Tarquin]] deleted "Mole (espianoge)" <em>(just babble)</em> |
|||
#10:33 Oct 7, 2002 [[User:Andre Engels|Andre Engels]] deleted "Image:Pistols.jpg" <em>(I thought I already did this one - copyright image)</em> |
|||
#10:32 Oct 7, 2002 [[User:Andre Engels|Andre Engels]] deleted "Image:Sulfanilamide.png" <em>(I thought I already did this one - replaced by sulfanilamide2.png)</em> |
|||
#10:29 Oct 7, 2002 [[User:Andre Engels|Andre Engels]] deleted "Image:Pistols.jpg" <em>(copyrighted)</em> |
|||
#10:27 Oct 7, 2002 [[User:Andre Engels|Andre Engels]] deleted "Image:Sulfanilamide.png" <em>(has been replaced by sulfanilamide2.png)</em> |
|||
#07:57 Oct 7, 2002 [[User:Isis|Isis]] deleted "Beverly K Effinger" <em>(mistakenly created w/out period on title initial)</em> |
|||
#07:54 Oct 7, 2002 [[User:Jheijmans|Jheijmans]] deleted "Guido Carli" <em>(empty, prev \"Put your text for the new page here. wwwc f df e ret fg ert et gf et e fg rg fg\")</em> |
|||
#06:59 Oct 7, 2002 [[User:Jheijmans|Jheijmans]] deleted "Djibouti/Temp" <em>(temporary page)</em> |
|||
#06:57 Oct 7, 2002 [[User:Maveric149|Maveric149]] deleted "Zebulun Kurth-Nelson" <em>(orphan, contents moved to meta; Content moved to m:Zebulun Kurth-Nelson. )</em> |
|||
#06:53 Oct 7, 2002 [[User:Maveric149|Maveric149]] deleted "Clark Prensoil Potter" <em>(just a link to meta: see m:Clark Pernsoil Potter )</em> |
|||
#06:52 Oct 7, 2002 [[User:Maveric149|Maveric149]] deleted "Spoken game" <em>(just a link to another article; \"[[improvisation]]\" )</em> |
|||
#06:32 Oct 7, 2002 [[User:Jheijmans|Jheijmans]] deleted "Airglow" <em>(empty, prev \"Put your text for the new page here. i have no fucking clue\")</em> |
|||
#06:32 Oct 7, 2002 [[User:Jheijmans|Jheijmans]] deleted "Interjection" <em>(empyt, prev \"BullShit - founded in 1948\")</em> |
|||
#06:31 Oct 7, 2002 [[User:Jheijmans|Jheijmans]] deleted "Babington Conspiracy" <em>(\"a\")</em> |
|||
#06:31 Oct 7, 2002 [[User:Jheijmans|Jheijmans]] deleted "Executive department" <em>(\"this is the executive branch.\")</em> |
|||
#06:30 Oct 7, 2002 [[User:Jheijmans|Jheijmans]] deleted "Second Athenian Empire" <em>(\"www.new-revo.com !! You love it!\")</em> |
|||
#06:30 Oct 7, 2002 [[User:Jheijmans|Jheijmans]] deleted "Stirrer" <em>(\"Put your text for the new page here.;pl\")</em> |
|||
#05:53 Oct 7, 2002 [[User:WojPob|WojPob]] deleted "Chinese grammar" <em>(no content, no history, deleted)</em> |
|||
#04:26 Oct 7, 2002 [[User:Maveric149|Maveric149]] deleted "Sexual perversion" <em>(hello )</em> |
|||
#01:50 Oct 7, 2002 [[User:Andre Engels|Andre Engels]] deleted "Walter Benjamin" <em>(\" Put your text for the new page here. bbuhjbhubhuuuuuuuuuuuuuuuubuhuuuuuuuuuuuuuuuuuuuuuuuuu\")</em> |
|||
⚫ | |||
<li>04:26 Oct 7, 2002 [[User:Maveric149|Maveric149]] deleted "Sexual perversion" <em>(hello )</em></li> |
|||
#01:45 Oct 7, 2002 [[User:Andre Engels|Andre Engels]] deleted "One-party system" <em>(\"Hey whatssup\")</em> |
|||
⚫ | |||
⚫ | |||
#23:43 Oct 6, 2002 [[User:Maveric149|Maveric149]] deleted "Rod Carew" <em>(nonarticle; \"Rod Carew was good at playing games. He also was a huge asshole. \")</em> |
|||
#23:40 Oct 6, 2002 [[User:Maveric149|Maveric149]] deleted "Central heating" <em>(Newbie experiment; \"HI my name is joe \" Hello Joe! Visit the help button on the top of your page to see what the project is about)</em> |
|||
#23:36 Oct 6, 2002 [[User:Maveric149|Maveric149]] deleted "Internet service provider" <em>(need to get this out of the way for a move)</em> |
|||
#21:50 Oct 6, 2002 [[User:Tarquin|Tarquin]] deleted "National Trust (England, Wales and Northern Ireland) properties" <em>(new page; content moved elsewhere; deletion requested by Nevilley)</em> |
|||
#21:45 Oct 6, 2002 [[User:Tarquin|Tarquin]] deleted "Parse tree" <em>(no intelligible content)</em> |
|||
#19:56 Oct 6, 2002 [[User:Jheijmans|Jheijmans]] deleted "Ellobiopsids" <em>(\"kevin michael allesee is the coolest\")</em> |
|||
#19:56 Oct 6, 2002 [[User:Jheijmans|Jheijmans]] deleted "Spoken game" <em>([[improvisation]])</em> |
|||
#19:55 Oct 6, 2002 [[User:Jheijmans|Jheijmans]] deleted "Olga Pyleva" <em>(\"Put your text for the new page here.Olga\")</em> |
|||
#19:55 Oct 6, 2002 [[User:Jheijmans|Jheijmans]] deleted "New Ipswich, New Hampshire" <em>(\"Rickard F\")</em> |
|||
#19:55 Oct 6, 2002 [[User:Jheijmans|Jheijmans]] deleted "A00 Sokolsky Opening 1.e4 e5" <em>(delete requested by initiaor of page)</em> |
|||
#11:08 Oct 6, 2002 [[User:Maveric149|Maveric149]] deleted "Krypton/Temp" <em>(temp page that is no longer needed)</em> |
|||
#10:32 Oct 6, 2002 [[User:WojPob|WojPob]] deleted "Tezpur, Assam" <em>(no content, no history, deleted)</em> |
|||
#10:30 Oct 6, 2002 [[User:WojPob|WojPob]] deleted "Stephen King/Dolans Cadillac" <em>(no content, no history, deleted)</em> |
|||
#07:36 Oct 6, 2002 [[User:Koyaanis Qatsi|Koyaanis Qatsi]] deleted "Not Black supremacy" <em>(\"Put your text for the new page here. uhm...yea...you suck \")</em> |
|||
#07:17 Oct 6, 2002 [[User:Jheijmans|Jheijmans]] deleted "Mythology of demons" <em>(empty, \"yo here is what i say fuck off le let me stay\")</em> |
|||
#07:16 Oct 6, 2002 [[User:Jheijmans|Jheijmans]] deleted "Babington Conspiracy" <em>(empty, \"you shouldn\'t allow people to edit these pages\" )</em> |
|||
#07:15 Oct 6, 2002 [[User:Jheijmans|Jheijmans]] deleted "Diplomonads" <em>(\"lick my balls\" )</em> |
|||
#07:15 Oct 6, 2002 [[User:Jheijmans|Jheijmans]] deleted "Moose Jaw" <em>(\"31000 POPULATION\" )</em> |
|||
#07:15 Oct 6, 2002 [[User:Jheijmans|Jheijmans]] deleted "1 E21 m" <em>(\"girth of my wang\" (by user Hfastedge?))</em> |
|||
#07:14 Oct 6, 2002 [[User:Jheijmans|Jheijmans]] deleted "Florianus" <em>(eh? )</em> |
|||
#21:37 Oct 5, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Junk page that is being deleted to confirm bug is fixed" <em>(Deletion log time zone bug)</em> |
|||
#23:15 Oct 5, 2002 [[User:WojPob|WojPob]] deleted "Mass Production" <em>(no content, no history, removed)</em> |
|||
#09:51 Oct 5, 2002 [[User:Maveric149|Maveric149]] deleted "Helsinki" <em>(getting this out of the way for a move; just a redirect)</em> |
|||
#14:13 Oct 5, 2002 [[User:The Epopt|The Epopt]] deleted "C-46 Commando" <em>(copyright violation)</em> |
|||
#14:13 Oct 5, 2002 [[User:The Epopt|The Epopt]] deleted "C-47 Skytrain" <em>(copyright violation)</em> |
|||
#14:29 Oct 5, 2002 [[User:Scipius|Scipius]] deleted "Das Kapital" <em>(Full text: moon boom)</em> |
|||
#06:19 Oct 5, 2002 [[User:Maveric149|Maveric149]] deleted "Human" <em>(just a redirect; no history; need to get this out of the way for a move)</em> |
|||
#06:17 Oct 5, 2002 [[User:Maveric149|Maveric149]] deleted "Humans" <em>(just a redirect, has never been anything else; need to get this out of the way for a complicated move)</em> |
|||
⚫ | #13:10 Oct 5, 2002 [[User:Scipius|Scipius]] deleted "Testingwhetherthereisalimittothelengthsofpagenamesddlskdlaskdnvlknancsklnasnfdoaiwnrpiwnrpqnrpqwnrpiqnneifniqnfiqwnipqwnfiqwnfiqwnfpiwqnfpinfipqnfipqwnfipnqwfpniwnfqpmmqcpomowmcmcopqwmpowcmopqwmcoqwpmcowpqmcopqmwcopwmcopmqcwopmcopqmwocpmwocmopcwqmopwqmcop" <em>(Lir was testing the pagename length)</em> |
||
<li>06:19 Oct 5, 2002 [[User:Maveric149|Maveric149]] deleted "Human" <em>(just a redirect; no history; need to get this out of the way for a move)</em></li> |
|||
#19:26 Oct 4, 2002 [[User:Maveric149|Maveric149]] deleted "Wikipedia:Tom Tommorrow" <em>(orphan, made my mistake)</em> |
|||
#21:44 Oct 4, 2002 [[User:Tarquin|Tarquin]] deleted "Coppicing/pollarding" <em>(new page; already moved to better title)</em> |
|||
⚫ | |||
#22:58 Oct 4, 2002 [[User:Ed Poor|Ed Poor]] deleted "SPIHT" <em>(graffiti)</em> |
|||
#20:35 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "Horace de Saussure" <em>(\"Put your text for the new page\")</em> |
|||
#20:35 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "Cisternae" <em>(\"ur a dork and a half.\")</em> |
|||
#20:35 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "Israeli Security Zone" <em>(empty, prev \"hola it\'s me\'s again ha ha ha ha.\")</em> |
|||
#20:35 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "United Nations Partition Plan" <em>(empty, prev \"hola chicos, and chicas. me just a normal school kid at school. i don\'t know what i\'m doing so audios\")</em> |
|||
#17:39 Oct 4, 2002 [[User:Koyaanis Qatsi|Koyaanis Qatsi]] deleted ".phtml" <em>(total content == \"Yo wazzup! Nothin\' here. Surf somewhere else. LOL ROTFL\", no pages linking to it, possiblly created to attempt some kind of exploit)</em> |
|||
#18:43 Oct 4, 2002 [[User:Ed Poor|Ed Poor]] deleted "State sponsors of terrorism" <em>(created this redirect page by mistake)</em> |
|||
#17:43 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "Ghent" <em>(getting out of the way for move)</em> |
|||
#12:55 Oct 4, 2002 [[User:Andre Engels|Andre Engels]] deleted "Pearson Hashing" <em>(newbie test)</em> |
|||
#12:37 Oct 4, 2002 [[User:Andre Engels|Andre Engels]] deleted "Duck duck goose" <em>(\"The only game yet created where the winner, indeed, becomes the duck\")</em> |
|||
#12:05 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "Exchange rate" <em>(\"Put your text for the new page here.ppp\")</em> |
|||
#11:10 Oct 4, 2002 [[User:Andre Engels|Andre Engels]] deleted "Red Sonja" <em>(Wikipedia is not a link depository (\"Read the review <a href=\"http://www.thespinningimage.co.uk/cultfilms/displaycultfilm.asp?reviewid=265\">here.</a>\"))</em> |
|||
#11:07 Oct 4, 2002 [[User:Andre Engels|Andre Engels]] deleted "Johan Helsingius" <em>(\"A big guy with tiny balls\")</em> |
|||
#11:01 Oct 4, 2002 [[User:Andre Engels|Andre Engels]] deleted "I didn't change anything!" <em>(phrase not characteristic enough to warrant an encyclopedia entry; been put on \'Votes for deletion\' by Jeronimo qabout 2 weeks ago)</em> |
|||
#08:54 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "Emotional punditry" <em>(redirect, needed for move)</em> |
|||
#08:54 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "Environmental wacko" <em>(redirect, needed for move)</em> |
|||
#08:51 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "StarEdit" <em>(redirect, needed for move)</em> |
|||
#08:49 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "Thames/pollution" <em>(\"Just an empty page at the moment.\")</em> |
|||
#08:45 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "Ekumen" <em>(redirect, needed for move)</em> |
|||
#08:44 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "The Dispossessed" <em>(redirect, needed for move)</em> |
|||
#08:34 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "Vitamin E familial isolated, deficiency of" <em>(copyright violation, been on votes for deletion for some time)</em> |
|||
#08:34 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "Clara Thrupp" <em>(\"She was born on the 1st July 1992. She has been in some school plays. One of her most famous roles was as a vogue dancer and in the choir. \" listed on votes for some time)</em> |
|||
#08:33 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "Eric Hoffman" <em>(personal page about a family member of a user (Grouse). \"contents\" already on that page.)</em> |
|||
#08:32 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "Talk:Belief" <em>(talk page of removed page)</em> |
|||
#08:32 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "Belief" <em>(no contents, been on votes for deletion for some time)</em> |
|||
#08:31 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "Carol" <em>(copyright violation, been on votes for deletion for some time)</em> |
|||
#08:29 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "Dinant" <em>(\"Put your text for the new page here. Dinantee\")</em> |
|||
#08:29 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "Stevertigo" <em>(\"i can be emailed at stevertigo@nupedia.com\")</em> |
|||
#08:29 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "Secret key" <em>(\"testing one two three\")</em> |
|||
#08:29 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "Dorchester, England" <em>(\"An English place\")</em> |
|||
#08:29 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "G3" <em>(\"Banas\")</em> |
|||
#08:28 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "Philosophical Investigations/family resemblance" <em>(empty, prev \"When the bird meets the bee, you lookalike both the bird and bee. Logically it can be expressed a=b=ab. In this way, you lookalike the rest of your clan.\")</em> |
|||
#08:28 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "Aswan High Dam" <em>(empty, prev \"khbkjgabkjglkjdfjgljdhgl;ihuitkjkgjbdkjfvbbvkjdbvbjkbjkbvkdbvkvbskjvbv kjbbiufdbv\")</em> |
|||
#08:28 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "U.s. presidental election, 1948" <em>(empty, prev \"The election of 1948 was considered by far the most fucked up of them all (cont.)\")</em> |
|||
#08:27 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "Sunset" <em>(empty, prev \"LASER (repeated a lot of times)\" )</em> |
|||
#08:27 Oct 4, 2002 [[User:Jheijmans|Jheijmans]] deleted "TWA 847 hijacking" <em>(empty, no previous contents)</em> |
|||
#06:22 Oct 4, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Green economics" <em>(History is a series of redirects and a cut-n-paste from [[Green economist]]. Deleting to make room for rename of that page in this page.)</em> |
|||
#08:18 Oct 4, 2002 [[User:WojPob|WojPob]] deleted "Howdoudeleteapage" <em>(no significant history, deleted)</em> |
|||
#23:58 Oct 3, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Green Economism" <em>(Cut-n-paste move from [[Green economist]]; no actual editing history. Text has been moved back there, need to remove to make room for potential rename)</em> |
|||
#19:15 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "Existentialism/Old" <em>(old text, copied to talk)</em> |
|||
#18:27 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "Toe" <em>(\"Toe: a finger like object that grows off the foot.\")</em> |
|||
#18:26 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "Electrostatic field" <em>(\"Put your text for the new page here. ciao\")</em> |
|||
#18:25 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "Henri Désiré Landru" <em>(\"PLEASE FILL THIS IN!\")</em> |
|||
#18:24 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "Marcel Petiot" <em>(\"hello i am alex\")</em> |
|||
#10:27 Oct 3, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Santa Cruz Operation" <em>(Cut-n-paste from [[SCO]], no history; needs to be deleted to make room for a proper rename)</em> |
|||
#12:16 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "Adzuki bean" <em>(\"Adzuki bean\")</em> |
|||
#11:48 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "Obfuscating software" <em>(\"asdfasdf\")</em> |
|||
#10:28 Oct 3, 2002 [[User:Tarquin|Tarquin]] deleted "Hazaed (game)" <em>(name with typo)</em> |
|||
#11:19 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "Brazil's anthem, entitled Hino Nacional Brasileiro" <em>(poorly title and \"HIOugpgu\" as content)</em> |
|||
#09:10 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "San Marino/Temp" <em>(temporary page)</em> |
|||
#09:01 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "Seth Howard" <em>(already on meta)</em> |
|||
#09:01 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "Weak entity" <em>(\"hello\")</em> |
|||
#09:00 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "Philip III of Spain" <em>(\"Philip III of Spain. hi!!!!\")</em> |
|||
#08:58 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "Charles Spurgeon" <em>(copyright violation, been on votes for deletion for some time)</em> |
|||
#08:57 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "Hans Eijsackers" <em>(copyright violation, been on votes for deletion for some time)</em> |
|||
#08:57 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "Morals or Ethics" <em>(already on meta)</em> |
|||
#08:56 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "Curved Air" <em>(copyright violation, been on votes for deletion for some time)</em> |
|||
#08:56 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "Bad Religion" <em>(copyright violation, been on votes for deletion for some time)</em> |
|||
#08:55 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "Pcl" <em>(\"Dit is een test van Jan-WIllem\")</em> |
|||
#08:55 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "Meersburg" <em>(\"http://www.mainau.de/\")</em> |
|||
#08:54 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "Mainau Island" <em>(\"http://www.mainau.de/ \")</em> |
|||
#08:54 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "Hugh Richardson" <em>(\"hee hee hee hee\")</em> |
|||
#08:53 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "Andraé Crouch" <em>(empty, prev \"I would like to edit this, if only I knew what to do...lol\")</em> |
|||
#08:53 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "Battle of Lexington and Concord" <em>(empyt, prev \"what did the blind man say as he walked past the tuna factory?\")</em> |
|||
#08:52 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "Flight AF 8969 Alger-Paris hijacked" <em>(empyt, prev \"your mom hijacked a plane but she was too fat to fit into a seat and it crashed anyway... \")</em> |
|||
#08:50 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "University of Kiel" <em>(empyt, prev \"A university of Phsycokenises in Northern Germany\")</em> |
|||
#08:50 Oct 3, 2002 [[User:Jheijmans|Jheijmans]] deleted "Yang di-Pertuan Agong" <em>(empyt, prev \"king\")</em> |
|||
#23:48 Oct 2, 2002 [[User:Maveric149|Maveric149]] deleted "Predicate calculus" <em>(junk \" Put your text for the new page here.ggbvbvbvbbvbvbvbvbvbvbv \")</em> |
|||
#23:46 Oct 2, 2002 [[User:Maveric149|Maveric149]] deleted "Radon/Temp" <em>(temp page that is no longer needed)</em> |
|||
#19:47 Oct 2, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Battle of Lutzen" <em>(useless non-article just says \"Lutzen\")</em> |
|||
#19:45 Oct 2, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Talk:Electronic filter" <em>(garbage left long ago by a passing IP: \" Its wikkid, www.horlix.com\")</em> |
|||
#19:15 Oct 2, 2002 [[User:PierreAbbat|PierreAbbat]] deleted "Blue Gene" <em>(garbage by 65.58.149.45; only content: \"FUCK FUCK FUCK\")</em> |
|||
#01:43 Oct 3, 2002 [[User:Andre Engels|Andre Engels]] deleted "Roman emperor" <em>(created this as a redirect to a page I thought existed but didn\'t)</em> |
|||
#22:00 Oct 2, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Peasants' Revolt" <em>(Junk comment, was recommended for deletion, need to take it out to make room for renaming better already existing article)</em> |
|||
#23:29 Oct 2, 2002 [[User:Andre Engels|Andre Engels]] deleted "Port Royal" <em>( this is pathetic you dont even have info!! hello???)</em> |
|||
#22:04 Oct 2, 2002 [[User:Tarquin|Tarquin]] deleted "Antiwikipedic" |
|||
<li>22:00 Oct 2, 2002 [[User:Brion VIBBER|Brion VIBBER]] deleted "Peasants' Revolt" <em>(Junk comment, was recommended for deletion, need to take it out to make room for renaming better already existing article)</em></li> |
|||
#21:47 Oct 2, 2002 [[User:Tarquin|Tarquin]] deleted "Antiwikipedic" <em>(no, it\'s already been agreed that this page belongs on the Meta site. If I\'m mistaken, please let me know on my talk page. And besides, you shouldn\'t create pages with no content)</em> |
|||
#21:40 Oct 2, 2002 [[User:Tarquin|Tarquin]] deleted "Antiwikipedic" <em>(hello, goodbye)</em> |
|||
#22:43 Oct 2, 2002 [[User:-- April|-- April]] deleted "Antiwikipedic" <em>(Exists on meta.)</em> |
|||
#22:27 Oct 2, 2002 [[User:-- April|-- April]] deleted "Antiwikipedic" <em>(Article is on meta /and/ Wikipedia namespace. Doesn\'t belong here. )</em> |
|||
#20:28 Oct 2, 2002 [[User:-- April|-- April]] deleted "Antiwikipedic" <em>(Not a word. Page exists on meta. IP blocked.)</em> |
|||
#20:24 Oct 2, 2002 [[User:-- April|-- April]] deleted "Antiwikipedic" <em>(Not a word. Page exists on meta.)</em> |
|||
#20:09 Oct 2, 2002 [[User:-- April|-- April]] deleted "Wikipedic" <em>(Page exists on meta, where it belongs. Use [[m:Wikipedic]] to reference.)</em> |
|||
#20:08 Oct 2, 2002 [[User:-- April|-- April]] deleted "Wikipedia: Antiwikipedic" <em>(Page exists on meta, where it belongs.)</em> |
|||
#20:07 Oct 2, 2002 [[User:-- April|-- April]] deleted "Antiwikipedic" <em>(Page exists on meta, where it belongs.)</em> |
|||
#19:52 Oct 2, 2002 [[User:-- April|-- April]] deleted "Antiwikipedic" <em>(This is not a forum for creating terms. Place on meta or in wikipedia: namespace.)</em> |
|||
#15:54 Oct 2, 2002 [[User:Koyaanis Qatsi|Koyaanis Qatsi]] deleted "Antiwikipedic" <em>(this page is not encyclopedic material. wikipedia is not the place to coin a term or post original research)</em> |
|||
#15:43 Oct 2, 2002 [[User:Koyaanis Qatsi|Koyaanis Qatsi]] deleted "AntiWikipedic" <em>(deleted. not in error.)</em> |
|||
#00:42 Oct 3, 2002 [[User:Stephen Gilbert|Stephen Gilbert]] deleted "Stephen Gilbert" <em>(old, orphaned user page redirect)</em> |
|||
#00:32 Oct 3, 2002 [[User:Stephen Gilbert|Stephen Gilbert]] deleted "STG" <em>(my old sig redirect, now an orphan)</em> |
|||
#17:01 Oct 2, 2002 [[User:Andre Engels|Andre Engels]] deleted "Laurasia" <em>(Full text: \"hello?\")</em> |
|||
#16:52 Oct 2, 2002 [[User:Andre Engels|Andre Engels]] deleted "CTSS" <em>(I was just wondering what CTSS is and thought if I clicked that link I would find my answer. )</em> |
|||
#16:17 Oct 2, 2002 [[User:Jheijmans|Jheijmans]] deleted "Maurice" <em>(\"huh?\")</em> |
|||
#14:01 Oct 2, 2002 [[User:Andre Engels|Andre Engels]] deleted "Riptor's articles" <em>(recently created User page; moved to User:Riptor/Riptor\'s articles)</em> |
|||
#09:20 Oct 2, 2002 [[User:Jheijmans|Jheijmans]] deleted "Transaction processing" <em>(\"JKJKJKJ\")</em> |
|||
#09:08 Oct 2, 2002 [[User:Jheijmans|Jheijmans]] deleted "In Vitro Fertilisation/Todo" <em>(obsolete subpage, contents in talk)</em> |
|||
#08:50 Oct 2, 2002 [[User:Andre Engels|Andre Engels]] deleted "Global warming/Todo" <em>(Old /Todo page; content has been copied to Global warming:Talk)</em> |
|||
#08:45 Oct 2, 2002 [[User:Jheijmans|Jheijmans]] deleted "Fuller Theological Seminary" <em>(\"http://www.fuller.edu\" )</em> |
|||
#08:23 Oct 2, 2002 [[User:Jheijmans|Jheijmans]] deleted "Pseudorandom" <em>(\"Put your text for the new page here. New page test\")</em> |
|||
#08:22 Oct 2, 2002 [[User:Jheijmans|Jheijmans]] deleted "Vaux-le-Vicomte" <em>(\"pussy?\")</em> |
|||
#08:21 Oct 2, 2002 [[User:Jheijmans|Jheijmans]] deleted "Ann Theresa de Keersmaker" <em>(empty, prev \"hoi\")</em> |
|||
#23:21 Oct 1, 2002 [[User:Maveric149|Maveric149]] deleted "Barney Rubble" <em>(off topic and slang usage to boot \" In England the term Barney is used against someone who is not a babe, but rather unattractive. \")</em> |
|||
#23:00 Oct 1, 2002 [[User:Maveric149|Maveric149]] deleted "Ned Ludd" <em>(junk \" douchebag \")</em> |
|||
#23:00 Oct 1, 2002 [[User:Maveric149|Maveric149]] deleted "Self-starvation" <em>(junk \" tyujjjj \")</em> |
|||
#22:57 Oct 1, 2002 [[User:Maveric149|Maveric149]] deleted "Middle High German" <em>(newbie experimenet \" hello \" Hi there)</em> |
|||
#22:54 Oct 1, 2002 [[User:Maveric149|Maveric149]] deleted "Aeolic" <em>(nebie experiment; \" hello there how are you? \" I\'m fine )</em> |
|||
#22:53 Oct 1, 2002 [[User:Maveric149|Maveric149]] deleted "Oliver Ellsworth" <em>(junk \" Put your text for the new page here. Wassup foos \")</em> |
|||
#22:52 Oct 1, 2002 [[User:Maveric149|Maveric149]] deleted "HMAS Darwin" <em>(removed website ad)</em> |
|||
#22:52 Oct 1, 2002 [[User:Maveric149|Maveric149]] deleted "Chemical burn" <em>(rubbish; \" Can cause up to 4th degree burns \" so can many other things)</em> |
|||
#22:51 Oct 1, 2002 [[User:Maveric149|Maveric149]] deleted "Fluoride" <em>(junk \" It\'s not a yummy substance...uck!! \")</em> |
|||
#18:57 Oct 1, 2002 [[User:Andre Engels|Andre Engels]] deleted "Stem cell/Todo" <em>(/Todo page from November last year. The actual text on the page has been moved to Talk:Stem cell)</em> |
|||
#01:06 Oct 2, 2002 [[User:Stephen Gilbert|Stephen Gilbert]] deleted "Wikipedia talk:What Google Likes" <em>(deleting my dumb mistake)</em> |
|||
#09:57 Oct 1, 2002 [[User:Tarquin|Tarquin]] deleted "Guiness Book of World Records" <em>(new page created with just offensive comment)</em> |
|||
#10:39 Oct 1, 2002 [[User:Jheijmans|Jheijmans]] deleted "Peat bog" <em>(empty, prev \"Hi, a peat bog is i don\'t know what\")</em> |
|||
#09:50 Oct 1, 2002 [[User:Jheijmans|Jheijmans]] deleted "Ashtanga Yoga" <em>(\"Brutal spankings.\")</em> |
|||
⚫ | |||
⚫ |
Latest revision as of 22:12, 17 July 2024
Wikipedia:Deletion log Archive for October 2002 (936 deletions)
[edit]- 22:08 Oct 31, 2002 Maveric149 deleted "Computer keyboard" (just a redirect page -- need to get this out of the way for a move)
- 20:47 Oct 31, 2002 Tarquin deleted "Solar tower" (no content)
- 15:55 Oct 31, 2002 Jheijmans deleted "Modern Pentathlon at the 1936 Summer Olympics" (\"Which male won the 100 and 200 meter gold medals?\")
- 09:43 Oct 31, 2002 Magnus Manske deleted "Saint-Cyr" (Says \"Cyr = Cyriacus Quiriacus = Quiricus\")
- 08:46 Oct 31, 2002 Magnus Manske deleted "Data storage" (newbie experiment)
- 08:11 Oct 31, 2002 Jheijmans deleted "Liar (short story)" (what)
- 08:11 Oct 31, 2002 Jheijmans deleted "Sumerian Early Dynastic period" (you all suck)
- 08:10 Oct 31, 2002 Jheijmans deleted "Analog first generation" (Put your text for the new page here. FHFHFHFH)
- 08:10 Oct 31, 2002 Jheijmans deleted "Automaton" (hello how are u)
- 08:10 Oct 31, 2002 Jheijmans deleted "State diagram" (abUababa)
- 08:10 Oct 31, 2002 Jheijmans deleted "Talk:2209" (talk of delete dpage)
- 08:10 Oct 31, 2002 Jheijmans deleted "2209" (\"hola nietos , espero q esten q esten bien , y el sida no sea problema , fernando lopina buenos aires octubre del 2002\")
- 08:09 Oct 31, 2002 Jheijmans deleted "Turing reduction" (\"Wikipedia (n): 1) Wikipedia derives its meaning from the Greek words \"Wiki\", meaning \"The\", and \"pedia\" meaning \"Free Encyclopedia.\" How these two unrelated words were combined into \"Wikipedia\" remains lost in the annals of time.\")
- 08:09 Oct 31, 2002 Jheijmans deleted "Kitakyushu" (\"Put your text for the new page here. \'\")
- 08:08 Oct 31, 2002 Jheijmans deleted "Fraser River" (\"Put your text for the new page here. this web site sux a$$\")
- 08:08 Oct 31, 2002 Jheijmans deleted "La Cliqua" (\"Put your text for the new page here. Hello all. I need some good music for my really boring French2 class. My teacher said we could get something a little more \"hip. Get me some sik beats! Merci. Musique fableaux! Tres chic et neveau.\")
- 08:07 Oct 31, 2002 Jheijmans deleted "Ad hoc protocol list" (\"Some of the existing protocols:\")
- 07:37 Oct 31, 2002 JeLuF deleted "Sir Andrew Ramsay" (Content: \"he was cool\", 172.164.123.242)
- 07:37 Oct 31, 2002 JeLuF deleted "Synonymy" (Content: \"abdi jumped the window\", 137.111.13.32)
- 06:48 Oct 31, 2002 Sjc deleted "Peter Tosh" (This page is unsavable when edited. Bug report submitted.)
- 05:32 Oct 31, 2002 Brion VIBBER deleted "Christian Dior" (Garbage by 64.166.108.167; only text \"fucking loser\")
- 05:22 Oct 31, 2002 Maveric149 deleted "Rhenium/Temp" (temp page that is no longer needed)
- 03:36 Oct 31, 2002 PierreAbbat deleted "Richard Leakey" (newbie experiment by 208.224.150.138: \"he is cool\")
- 23:58 Oct 30, 2002 PierreAbbat deleted "Charles's law" (low-entropy junk by 152.163.188.2: \"AAAAAAA\"...)
- 22:55 Oct 30, 2002 The Epopt deleted "Agosta 90B class submarine" (deletion of redirect to allow move)
- 20:36 Oct 30, 2002 JeLuF deleted "Olde Cheshire Cheese (London pub)" (Content: \"Metta il vostro testo per la nuova pagina qui.prpducco formaggio staggionato con pezzi di vemi,è un formaggio a base di latte del toro \", 80.206.239.230)
- 20:35 Oct 30, 2002 JeLuF deleted "Top-down" (Content: \"Put your text for the new page here. gfsgs\", 128.211.249.253)
- 20:34 Oct 30, 2002 JeLuF deleted "Nearest neighbor algorithm" (Content: some hundred random characters, 211.72.158.234)
- 20:33 Oct 30, 2002 JeLuF deleted "Dog whistle" (Content: \"sfsfsdgggs\", 142.22.16.54)
- 20:32 Oct 30, 2002 JeLuF deleted "Sforzando" (Content: \"Put your text for the new page here. yeah, whatever \", 208.32.128.10)
- 18:57 Oct 30, 2002 Tarquin deleted "BLT sandwitch" (mispeeling)
- 18:56 Oct 30, 2002 Tarquin deleted "BLT sandwich" (making way)
- 18:54 Oct 30, 2002 Tarquin deleted "Club sandwich" (no content)
- 15:51 Oct 30, 2002 Tarquin deleted "N'Djamena" (212.219.189.245 -- go home)
- 15:50 Oct 30, 2002 Ed Poor deleted "Renaming page, as suggested" (completing move)
- 15:46 Oct 30, 2002 Tarquin deleted "WikiWiki)" (daft title)
- 15:37 Oct 30, 2002 Magnus Manske deleted "WikiWiki)" (newbie test)
- 12:52 Oct 30, 2002 Brion VIBBER deleted "CMOS Memory" (Newbie experiment; \"Put your text for the new page here. are you kidding me?\")
- 12:14 Oct 30, 2002 Tarquin deleted "Nipple piercing" (junk entry. Hey, it\'d be a junk entry no matter *what* people wrote here. Wikipedia does not encourage self-mutilation, blah blah)
- 10:50 Oct 30, 2002 Jheijmans deleted "De Witt Clinton" (empty, prev \"what? i don\'t want to edit, i want to read...this isn\'t helping me with m term paper...\")
- 10:50 Oct 30, 2002 Jheijmans deleted "Preda Mihailescu" (empty, prev \"Poos\")
- 10:50 Oct 30, 2002 Jheijmans deleted "When it Happens" (\"When It Happens, by Margaret Atwood\")
- 10:49 Oct 30, 2002 Jheijmans deleted "Mossel Bay" (empty, prev \"Put your text for the new page here. what exactly is Mossel Bay?\")
- 04:32 Oct 30, 2002 Brion VIBBER deleted "Zu Chen" (Garbage by 203.166.47.226; only content \"she is silly\")
- 04:32 Oct 30, 2002 Brion VIBBER deleted "Jun Xie" (Garbage by 203.166.47.226; only content \"she is dum\")
- 01:28 Oct 30, 2002 PierreAbbat deleted "Henri Désiré Landru" (garbage by 64.12.96.102: \"u are abasshole\", since deleted)
- 23:10 Oct 29, 2002 Brion VIBBER deleted "Mercury-in-glass thermometer" (\"Put your text for the new page here.uufifki , t 9i 8rg ij trj ju j jrttjj j 5ju jt ujutjuijuf0 ij ijjjjjj i0 9i juj j ju ju j u8juj 90 ij 0j8 vuiujfhuyi j u8hfooj guity tryt rgrrg.\")
- 23:01 Oct 29, 2002 PierreAbbat deleted "Thylakoid" (nonsense by 24.197.134.228: \"dskfudfsg\")
- 22:54 Oct 29, 2002 PierreAbbat deleted "Image:Vaag.JPG" (Junk image. Some screen in Dutch showing the epoch as an erroneous time, circled.)
- 21:26 Oct 29, 2002 Jheijmans deleted "Edit" (empty, bullshit before)
- 21:26 Oct 29, 2002 Jheijmans deleted "Tramping" (\"New Zealand epxression for hiking.\")
- 20:20 Oct 29, 2002 JeLuF deleted "Lloyd Bentsen" (Content: \"Put your text for the new page here. Lloyd I love You \")
- 19:21 Oct 29, 2002 Tarquin deleted "Harry Potter and the Order of the Phoenix" (go home kids)
- 17:32 Oct 29, 2002 Ed Poor deleted "Moscow theatre siege" (make room for move)
- 13:59 Oct 29, 2002 Brion VIBBER deleted "Hitler: The Last Ten Days" (Garbage, no history; only content \"he had sex with his dog\". (156.63.205.5))
- 13:52 Oct 29, 2002 Brion VIBBER deleted "Battle of Otford" (Only content \"Put your text for the new page here. THE BATTLE OF OTFORD IS STILL ONGOING, I HAVE A BATTLE TO PARK MY CAR EVERY TIME I GO THERE\" - moved to Bad jokes and other deleted nonsense page)
- 13:31 Oct 29, 2002 Brion VIBBER deleted "Talk:Hafez al-Assad" (Garbage; only content \"he gave good head\")
- 13:30 Oct 29, 2002 Brion VIBBER deleted "Image talk:Hitler.jpg" (Garbage; only content \"he was a gay fucker\")
- 13:27 Oct 29, 2002 Brion VIBBER deleted "Sukarno" (Garbage; only content \'he liked getting fucked in the ass. He had a homosextual boyfriend named kyle rooney. they had sex all the time.\')
- 13:26 Oct 29, 2002 Brion VIBBER deleted "Suharto" (No history; only content \"eat my dick\")
- 11:26 Oct 29, 2002 Karen Johnson deleted "X/Open" (one sentence stub does not relate to the title)
- 10:00 Oct 29, 2002 Karen Johnson deleted "Peasant rebellion" (empty orphaned list)
- 09:53 Oct 29, 2002 Karen Johnson deleted "University of Birmingham" (you may loooove the uni, but that\'s not an article)
- 09:51 Oct 29, 2002 Karen Johnson deleted "Dictionary of the Norwegian Dialects" (hei)
- 09:14 Oct 29, 2002 Brion VIBBER deleted "St. Paul's Cathedral" (No history; only content \"Pigs fly!!!\")
- 07:52 Oct 29, 2002 Jheijmans deleted "Bob Kane" (\"Co-creator of Batman.\")
- 07:13 Oct 29, 2002 JeLuF deleted "Pi-calculus" (Content: \"Mostly harmless\")
- 07:13 Oct 29, 2002 JeLuF deleted "Dwarf elliptical galaxy" (Content: \"This is a NEW PAGE -Do you like it????????????? \")
- 05:23 Oct 29, 2002 AxelBoldt deleted "Post system" (the contents \"erttywedsfgsdfgertg \" did not quite match expectations)
- 04:21 Oct 29, 2002 Koyaanis Qatsi deleted "Image:Aalayout.jpg" (some big (700 k card professing love for somebody, unused in any article))
- 03:27 Oct 29, 2002 PierreAbbat deleted "0001 B.C." (junk by 64.12.96.106. What\'s a \"poochi-wa\"?)
- 03:24 Oct 29, 2002 PierreAbbat deleted "Talk:Hydroelectricity" (junk by 24.76.80.198: \"sup\")
- 03:23 Oct 29, 2002 PierreAbbat deleted "Archaism" (mere def by 80.37.58.169: \"Use of an ancient word.\")
- 03:09 Oct 29, 2002 Karen Johnson deleted "Image:Marigoldthumbnail.pg.jpg" (mistaken identity)
- 03:07 Oct 29, 2002 Karen Johnson deleted "Mechanical energy" (vandalism)
- 03:06 Oct 29, 2002 Karen Johnson deleted "Breach of contract" (Ask Professor Kinsfield.)
- 03:06 Oct 29, 2002 Karen Johnson deleted "Isolating language" (things to be believed in)
- 03:05 Oct 29, 2002 Karen Johnson deleted "Gush Shalom" (shalom)
- 03:05 Oct 29, 2002 Karen Johnson deleted "Push-down automaton" (junk)
- 03:04 Oct 29, 2002 Karen Johnson deleted "Morrill act" (om)
- 01:03 Oct 29, 2002 Tarquin deleted "OMW" (junk entry)
- 19:43 Oct 28, 2002 JeLuF deleted "Free Software movement" (Content: \"this is my test page for compressing a text file using Lempel ziv compressio algorithm \")
- 18:23 Oct 28, 2002 Jheijmans deleted "Fabio" (\"im the hero\")
- 18:22 Oct 28, 2002 Jheijmans deleted "Application server" (\"AHMED\")
- 15:56 Oct 28, 2002 Ed Poor deleted "Unification Church and anti-Semitism" (making room for a \"Move\")
- 15:49 Oct 28, 2002 Tarquin deleted "Cut in" (junk entry)
- 14:12 Oct 28, 2002 Jheijmans deleted "Rembrandt" (needed for move - just a redirect)
- 12:51 Oct 28, 2002 Magnus Manske deleted "Asian crisis" (Says \" test test2\")
- 08:10 Oct 28, 2002 Maveric149 deleted "Nonviolence" (See ahimsa. = not an article)
- 07:53 Oct 28, 2002 Jheijmans deleted "Andorra la Vella" (redirect, needed for a move)
- 06:51 Oct 28, 2002 Karen Johnson deleted "Mitochondrial membrane" (I don\'t care if you want to learn more about cells - do your own research)
- 06:40 Oct 28, 2002 Karen Johnson deleted "Michigan Rummy" (vandalism)
- 06:10 Oct 28, 2002 Karen Johnson deleted "The war against Reform and Conservative Judaism" (article moved to talk pending removal entirely)
- 06:03 Oct 28, 2002 Koyaanis Qatsi deleted "David Matthews" (Put your text for the new page here.
V‚µ‚¢ƒy[ƒW‚Ì‚ ‚È‚½‚̃eƒLƒXƒg‚ð‚±‚±‚Å’u‚¢‚Ä‚‚¾‚³‚¢B ) - 05:50 Oct 28, 2002 Karen Johnson deleted "Demagoguery" (\'what is demagoguery? A pejorative synonym for demagogy)
- 05:47 Oct 28, 2002 Karen Johnson deleted "Motor coil resistance" (experiment)
- 05:40 Oct 28, 2002 Karen Johnson deleted "Hollywood Babylon" (Holly Wood Babylon is a book. - until someone can be more specific we don\'t need this!)
- 05:40 Oct 28, 2002 Karen Johnson deleted "Tax evasion" (i asked you weedo)
- 05:39 Oct 28, 2002 PierreAbbat deleted "Progenote" (Wikipedia is not a dictionary: \"universal ancestor\")
- 05:39 Oct 28, 2002 Karen Johnson deleted "Progenote" (universal ancestor )
- 05:38 Oct 28, 2002 Karen Johnson deleted "Tollund" (several generations of garbage!)
- 05:37 Oct 28, 2002 Karen Johnson deleted "Meet in the middle" (Hi I Am A Man.)
- 05:26 Oct 28, 2002 PierreAbbat deleted "Lock and key" (nonsense by 65.95.156.177: \"Put your text for the new page here. ff fdskjt fkdst eif dfjfj dflkjdsfsdf\")
- 02:53 Oct 28, 2002 Maveric149 deleted "Spindle" (spindle )
- 02:24 Oct 28, 2002 Karen Johnson deleted "Talk:Mystery" (the day for this self-advertisment is done... )
- 01:13 Oct 28, 2002 Isis deleted "Image:Tartan.PNG" (we\'re done talking about it)
- 00:58 Oct 28, 2002 Maveric149 deleted "Image:Tour group entering South Portal of Yucca Mountain.jpg" (Wrong name)
- 00:58 Oct 28, 2002 Maveric149 deleted "Image:Tour group entering South Portal of Yucca Mountain.jpg" (It\'s the /North/ Portal)
- 22:58 Oct 27, 2002 PierreAbbat deleted "Colouring algorithm" (nonsense by 131.238.116.232: \"Put your text for the new page here. sadasdasdasd\")
- 22:04 Oct 27, 2002 Jheijmans deleted "Frederick II of Naples" (empty, prev \"moo\")
- 21:10 Oct 27, 2002 Jheijmans deleted "Shopping mall" (\"Shopping center. The place/building where several stores are located. \")
- 20:20 Oct 27, 2002 Scipius deleted "Estonia/Temp" (Temp page no longer necessary)
- 19:45 Oct 27, 2002 JeLuF deleted "Black widow spider" (Content: \"Fuck that shit \")
- 19:37 Oct 27, 2002 Maveric149 deleted "Fort Garry" (ddfkld\' )
- 17:17 Oct 27, 2002 JeLuF deleted "Fluorescent light" (Content: \"Sup Dawgs \")
- 17:15 Oct 27, 2002 JeLuF deleted "Rollie Fingers" (Content: \" Put your text for the new page here. he is a penis eater \")
- 17:13 Oct 27, 2002 JeLuF deleted "Dogrib" (Content: \"The dogribs ate dog and wolf ribs! \")
- 17:06 Oct 27, 2002 JeLuF deleted "Page Widening" (Content: \"Slashdot sucks! \")
- 14:28 Oct 27, 2002 Magnus Manske deleted "Image:Soldierwithwings thumb.htm" (crap ;-))
- 12:31 Oct 27, 2002 Jheijmans deleted "User:Jheijmans/Zandbak" (some testing...)
- 12:03 Oct 27, 2002 Jheijmans deleted "Quantum dot computer" (\"Put your text for the new page here. dfd \")
- 12:02 Oct 27, 2002 Jheijmans deleted "Joel David Bondurant" (\"Famous mathematician and physicist. \")
- 12:01 Oct 27, 2002 Jheijmans deleted "Kassubian" (\"FUCK THE GODDAMN SLAVS!!! \")
- 08:34 Oct 27, 2002 JeLuF deleted "Goddess of Democracy" (Content:\" <A href=\"http://www.google.com\">hi</A> \")
- 07:41 Oct 27, 2002 Maveric149 deleted "John Wilkins" (Put your text for the new page here. John Wilkins )
- 03:13 Oct 27, 2002 Brion VIBBER deleted "Basidium" (by 63.20.117.149 -- no history, only content \"u dont know shit do u? NNNNOOOOOO!!\")
- 03:09 Oct 27, 2002 Brion VIBBER deleted "Espionage Act" (Non-article; only content \"The Espionage Act sucked and so did Palmer! Did you know that people can have sex all day every 30 mins?\")
- 02:34 Oct 27, 2002 PierreAbbat deleted "Eurpoean" (title is misspelled)
- 01:10 Oct 27, 2002 PierreAbbat deleted "Talk:Francesco Andreini" (newbie experiment by 68.44.116.247: only content \"Hello\")
- 22:04 Oct 26, 2002 Maveric149 deleted "User:194.117.133.196" (Vandal page)
- 21:58 Oct 26, 2002 Maveric149 deleted "Hilary rosen" (result of vandalism)
- 21:57 Oct 26, 2002 Maveric149 deleted "Excrement" (result of vandalism)
- 21:57 Oct 26, 2002 Maveric149 deleted "Contructophobia" (stub. )
- 21:56 Oct 26, 2002 Maveric149 deleted "0o0o0o0o0o0o0o0o0o0" (result of vandalism)
- 21:55 Oct 26, 2002 Maveric149 deleted "WikiWikiWikiWiki" (result of vandalism)
- 21:05 Oct 26, 2002 Maveric149 deleted "Greek Orthodox" (ee also under \"Suzy Khimm\". )
- 20:01 Oct 26, 2002 Danny deleted "Hormizd II of Persai" (typo in title)
- 18:56 Oct 26, 2002 Scipius deleted "Jules Bonnot" (Full text: \"sgh ahe \" (Edit Comment: ehhr))
- 15:17 Oct 26, 2002 Jheijmans deleted "Zacharias Janssen" (\"hi\")
- 15:16 Oct 26, 2002 Jheijmans deleted "Krankenhaus" (there\'s no need for redirects in German for normal English words)
- 15:15 Oct 26, 2002 Jheijmans deleted "Mayan hieroglyph" (\"karlisha ladawn monday \")
- 15:15 Oct 26, 2002 Jheijmans deleted "MIPS architecture/Instructions" (\"gjkhj \")
- 15:14 Oct 26, 2002 Jheijmans deleted "PC-DOS" (\"kij\")
- 14:15 Oct 26, 2002 Jheijmans deleted "China/Temp" (temporary page)
- 12:52 Oct 26, 2002 Jheijmans deleted "Ancient Roman eschatology" (empty, prev \"nice\")
- 12:52 Oct 26, 2002 Jheijmans deleted "Albert Luthuli" (empty, prev \" opgreLNÑ<N PEJNR wpj´mpo OPJ54W GWrou IOPNE ipoengklrek giopingre v9int n lh t3hioht\")
- 12:09 Oct 26, 2002 JeLuF deleted "Matabele" (Content: \"????\")
- 07:18 Oct 26, 2002 JeLuF deleted "Mars bar" (Content: \"Put your text for the new page here.adsasdasd\")
- 07:17 Oct 26, 2002 JeLuF deleted "IEEE 802.10" (Content: \"IEEE 802.10\")
- 05:18 Oct 26, 2002 The Cunctator deleted "Image:Paul Wellstone.jpg" (Not nec. public domain. I uploaded it.)
- 22:41 Oct 25, 2002 Ed Poor deleted "Talk:Ded reckoning" (page was moved -- nothing links here)
- 22:09 Oct 25, 2002 JeLuF deleted "Mo Vaughn" (Content: \"Again, how we can forget Chili Davis?? \")
- 22:08 Oct 25, 2002 JeLuF deleted "Wally Joyner" (Content: \"what about Chili Davis?? \")
- 21:03 Oct 25, 2002 JeLuF deleted "Mark Shuttleworth" (Content was random noise)
- 21:00 Oct 25, 2002 JeLuF deleted "Portal circulation" (Content: \"Put your text for the new page here. anastomosis porto-cava \")
- 20:51 Oct 25, 2002 JeLuF deleted "Random number generator" (Content: \"i don\'t want anything from you. just tell me what i told you before. \")
- 20:13 Oct 25, 2002 Tarquin deleted "Babylonian numerals" (junk entry)
- 19:16 Oct 25, 2002 Sjc deleted "User:193.251.9.132 is back for more" (Vandalism)
- 19:15 Oct 25, 2002 Koyaanis Qatsi deleted "Image:Hello.jpg" (goatse image from 193.251.9.132 is back for more)
- 19:15 Oct 25, 2002 Sjc deleted "Image:Hello.jpg" (Vandalism)
- 19:12 Oct 25, 2002 Koyaanis Qatsi deleted "Image:Widening" (not an image but text: \"It tastes like chicken, only with secret sause!\")
- 19:01 Oct 25, 2002 Koyaanis Qatsi deleted "Wikipedia:Ram-man" (\"um, yes, i spam wikipedia with useless autogenerated pages of US villages that no one gives a flying fuck about, please block me. I am insane! \" -- more from 193.251.9.132)
- 18:49 Oct 25, 2002 Sjc deleted "Klerckistheuberleetpagewidening-g0d-he-is-a-true-hax0r-he-forces-cmdrtaco-to-eat-feaces-because-he-is-sofucking-great-i-wonder-how-long-i-can-make-a-subject-be-fore-wikipedia-fux0rz-up-or-before-mozilla-does-it-probably-can-go-on-for-fucking-forever-if-i-" (Completely irredeemable nonsense. Amusing title nevertheless.)
- 18:43 Oct 25, 2002 Koyaanis Qatsi deleted "Klerckistheuberleetpagewidening-g0d-he-is-a-true-hax0r-he-forces-cmdrtaco-to-eat-feaces-because-he-is-sofucking-great-i-wonder-how-long-i-can-make-a-subject-be-fore-wikipedia-fux0rz-up-or-before-mozilla-does-it-probably-can-go-on-for-fucking-forever-if-i-" (Klerck, you are so l33t, i LOVE Page widening. g to the oatse c to the issex you are so fucking cool that i SHAT my pantx0rz )
- 18:29 Oct 25, 2002 Jheijmans deleted "Path integral" (\" The amount of hamburgers one man can eat in a day.\")
- 18:29 Oct 25, 2002 Jheijmans deleted "Statistical distribution" (\"Put your text for the new page here.extreme value \")
- 18:28 Oct 25, 2002 Jheijmans deleted "Precious metal" (\"Precious metals include gold, platinum, and silver. \"\")
- 18:26 Oct 25, 2002 Jheijmans deleted "Joel David Bondurant" (\"A famous american mathematician. \")
- 18:26 Oct 25, 2002 Jheijmans deleted "Buffalo Bill" (\"alias William Frederick Cody \")
- 18:26 Oct 25, 2002 Jheijmans deleted "Phylogenetic tree" (\" this is retarded \")
- 18:26 Oct 25, 2002 Jheijmans deleted "Residue" (\"Chewing Tobacco \")
- 18:25 Oct 25, 2002 Jheijmans deleted "Distance-vector routing protocol" (\" helloooooooooooo \")
- 18:25 Oct 25, 2002 Jheijmans deleted "Concordance" (empty, prev \" Put your text for the new page here. genitive \")
- 18:22 Oct 25, 2002 Jheijmans deleted "Cross-country running" (\"Emily\")
- 18:21 Oct 25, 2002 Jheijmans deleted "Royal Tombs of Ur" (\"u suck \")
- 18:21 Oct 25, 2002 Jheijmans deleted "Pictograph" (\"damion\")
- 18:21 Oct 25, 2002 Jheijmans deleted "Allotheria" (\"allotheria\")
- 18:21 Oct 25, 2002 Jheijmans deleted "Retrograde extrapolation" (empty, prev \" http://www.duicenter.com/ \")
- 18:21 Oct 25, 2002 Jheijmans deleted "Retrograde extrapolation" (empty, prev \" http://www.duicenter.com/ \")
- 18:20 Oct 25, 2002 Jheijmans deleted "Cape Fear" (empty, prev \"Put your text for the new page here. the cape fear \")
- 18:20 Oct 25, 2002 Jheijmans deleted "Pierre Sauvignon de Brazza" (empty, prev \"picture\")
- 15:50 Oct 25, 2002 Andre Engels deleted "Sulfide" (misnamed page, was about copper sulfides rather than sulfides in general; page and history moved to copper sulfide)
- 15:48 Oct 25, 2002 Andre Engels deleted "Cupper sulfide" (moved to wrong title; contents and history moved to copper sulfide)
- 09:35 Oct 25, 2002 Magnus Manske deleted "Markov algorithm" (just created, empty)
- 08:47 Oct 25, 2002 Karen Johnson deleted "Mahmud I" (garbage - the wikipedia is not a homework completion service)
- 00:27 Oct 25, 2002 Koyaanis Qatsi deleted "Locro" (Hey, my homies, wazzup? If u wanna be a hot chica go to ecuador where you can get tan and lean form the beaches and stuff... )
- 00:26 Oct 25, 2002 Koyaanis Qatsi deleted "Marching music" (Rach D smells )
- 21:18 Oct 24, 2002 JeLuF deleted "On-Line Medical Dictionary" (Former content: \"http://cancerweb.ncl.ac.uk/omd/ \", now empty)
- 21:17 Oct 24, 2002 JeLuF deleted "Bureau of Standards" (Content: \"Put your text for the new page here. wahaha \")
- 21:16 Oct 24, 2002 JeLuF deleted "Frozen Four" (Content: \"this game rocks my dick \")
- 21:15 Oct 24, 2002 JeLuF deleted "The Fall of the House of Usher" (Content: \"Hi i like eggs \")
- 21:13 Oct 24, 2002 JeLuF deleted "Minbar" (Content: \"Hull middle from duluth, Georgia rocks! \")
- 21:13 Oct 24, 2002 JeLuF deleted "John Purroy Mitchel" (Content: random noise)
- 21:12 Oct 24, 2002 JeLuF deleted "FFS" (Content: \"editing ffs\")
- 18:50 Oct 24, 2002 The Cunctator deleted "Talk:Beltway Sniper" (same as subject page.)
- 18:49 Oct 24, 2002 The Cunctator deleted "Beltway Sniper" (Moving back to singular. Only one sniper.)
- 17:26 Oct 24, 2002 Ed Poor deleted "Keep on trollin trollin trollin" (graffiti)
- 17:23 Oct 24, 2002 Koyaanis Qatsi deleted "Image:Hello.jpg" (goatse image)
- 14:08 Oct 24, 2002 Jheijmans deleted "Sunne" (needed for another page, is redirect)
- 13:42 Oct 24, 2002 Jheijmans deleted "-lvsbyn" (accidentally created by me)
- 13:14 Oct 24, 2002 Jheijmans deleted "Berg" (needed for another page, redirect to Alban Berg (not used))
- 08:01 Oct 24, 2002 Koyaanis Qatsi deleted "THX 1138:4EB" (Put your text for the new page here. hi )
- 07:42 Oct 24, 2002 Jheijmans deleted "Rustler's knot" (\"instructions for tying a rustler\'s knot\")
- 07:41 Oct 24, 2002 Jheijmans deleted "Duotrigintillion" (\"Put your text for the new page here.\")
- 07:41 Oct 24, 2002 Jheijmans deleted "Mudhoney" (empty, prev \"Mudhuney sucks.\")
- 07:40 Oct 24, 2002 Jheijmans deleted "Geheimfernschreiber" (empty, prev \"This is a test of the geheimfernschreiber code used by nazis in 1943. This test will be used in a report by Craig Warren in a report for praxis module year 1 computer science, Heriot Watt University.\")
- 07:40 Oct 24, 2002 Jheijmans deleted "Projection" (empty, prev \"Put hfgh\")
- 07:40 Oct 24, 2002 Jheijmans deleted "Channel 5/UK" (empty, prev \"Put your text for the new page here. rah\")
- 06:54 Oct 24, 2002 Brion VIBBER deleted "Simon peters" (Non-article; only content \"simon peters was found being gay with a boy nnamed andy collalo\")
- 04:07 Oct 24, 2002 Brion VIBBER deleted "Waring's problem" (Cut-n-paste from Warings problem. Need to delete it to make room for a proper rename of the article with history intact)
- 03:08 Oct 24, 2002 Brion VIBBER deleted "Propaganda/Slogans" (Non-article; only content \"Put your text for the new page here. asdasdasd\")
- 00:02 Oct 24, 2002 Lee Daniel Crocker deleted "Fred Olsen" (Similar random vandal page-creation.)
- 00:00 Oct 24, 2002 Lee Daniel Crocker deleted "James Rosenquist" (No content, no history, random vandal.)
- 23:22 Oct 23, 2002 Lee Daniel Crocker deleted "Minoan civilization" (Preparing for move)
- 22:26 Oct 23, 2002 Brion VIBBER deleted "Logging file system" (Non-article; only content \"???????\")
- 21:08 Oct 23, 2002 Brion VIBBER deleted "Bloomingberg, ohio" (More goatse.cx)
- 20:44 Oct 23, 2002 Brion VIBBER deleted "Wikipedia:VANDALISMS IN PROGRESS" (More goatse.cx)
- 20:34 Oct 23, 2002 JeLuF deleted "Gonville Hall, Cambridge" (Content was: \"Go\")
- 20:33 Oct 23, 2002 Maveric149 deleted "Spelling" (Put your text for the new page here. Thank you very much for your letter of support. It will be a pleasure to inform you when this project becomes available. )
- 20:33 Oct 23, 2002 JeLuF deleted "Morton's Fork" (Content was: \"test\")
- 20:32 Oct 23, 2002 JeLuF deleted "User:0" (empty page, deletion requested by Ortolan88)
- 20:29 Oct 23, 2002 Ed Poor deleted "The weather in London" (messing up the Wikipedia FAQ)
- 20:21 Oct 23, 2002 JeLuF deleted "Wikipedia:Sucks" (showing only the goats.cx-image)
- 20:20 Oct 23, 2002 Ed Poor deleted "Wikipedia:Sucks" (You didn\'t say WHY it sucks)
- 18:27 Oct 23, 2002 Maveric149 deleted "Pyramid of Djoser" (Getting this out of the way for a move back (Please read our naming conventions)
- 17:43 Oct 23, 2002 Stephen Gilbert deleted "Compound microscope" (solitation for cyber-sex)
- 17:23 Oct 23, 2002 Stephen Gilbert deleted "Tillibody" (obscure advertisement; deletion requested)
- 17:22 Oct 23, 2002 Stephen Gilbert deleted "Tagmemics" (copyright violation)
- 09:59 Oct 23, 2002 Andre Engels deleted "John Fahey" (\"This person is weird\")
- 08:10 Oct 23, 2002 Jheijmans deleted "Pet Sounds" (\"The first psychedellic album ever released.\")
- 08:10 Oct 23, 2002 Jheijmans deleted "Vince Clarke" (\"First synth player for Depeche Mode.\")
- 08:10 Oct 23, 2002 Jheijmans deleted "Charles Augustin de Coulumb" (\"hey guys!\")
- 08:09 Oct 23, 2002 Jheijmans deleted "Chuck Norris" (empty, prev \"Chuck Norris was not a Marine, he served in the US Air Force and picked up his knowledge on Martial Art while stationed in Korea\")
- 01:23 Oct 23, 2002 Brion VIBBER deleted "Beltway Sniper" (History is only cut-n-paste from Washington sniper. Need to remove to rename that article here.)
- 01:13 Oct 23, 2002 Koyaanis Qatsi deleted "Delete" (some oddness that came about from some action of Lir\'s--intentional or not, I don\'t know)
- 01:13 Oct 23, 2002 Koyaanis Qatsi deleted "Dqwe" (some oddness that came about from some action of Lir\'s--intentional or not, I don\'t know)
- 01:12 Oct 23, 2002 Koyaanis Qatsi deleted "Delete3432432" (some oddness that came about from some action of Lir\'s--intentional or not, I don\'t know)
- 01:12 Oct 23, 2002 Koyaanis Qatsi deleted "Delete123" (some oddness that came about from some action of Lir\'s--intentional or a bug, I don\'t know)
- 00:52 Oct 23, 2002 Karen Johnson deleted "Cock" (no actual info)
- 00:50 Oct 23, 2002 Karen Johnson deleted "Hillel Slovak" (the guy from the red hot chillio peppers )
- 00:49 Oct 23, 2002 Karen Johnson deleted "Surf Punks" (Local surfers into punk music & lifestyle. )
- 00:48 Oct 23, 2002 Karen Johnson deleted "Bass rap" (vandalism)
- 00:47 Oct 23, 2002 Karen Johnson deleted "Sir Andrew Ramsay" (asking for information)
- 00:45 Oct 23, 2002 Karen Johnson deleted "Sali Berisha" (foreign language microstub)
- 00:42 Oct 23, 2002 Karen Johnson deleted "Petronius" (no content)
- 00:07 Oct 23, 2002 Andre Engels deleted "Spiral galaxy" (\"Put your text for the new page here.fuuuuuuuuuuuuuuuuuuuuuuuuucccccccccccccccckkkkkkkkkkkkkkkkkkyyyyyyyyyyyyyyyyoooooooooooooooouuuuuuuuuuuuuu\" )
- 00:06 Oct 23, 2002 Andre Engels deleted "Cervidae" (\"no one likes you\")
- 00:05 Oct 23, 2002 Andre Engels deleted "Swiss Market" (\"Put your text for the new page here. market capitalization\")
- 00:03 Oct 23, 2002 Andre Engels deleted "William Rushton" (\"Put your text for the new page here. ???\")
- 19:47 Oct 22, 2002 Tarquin deleted "Lalalalalala" (stupid name.)
- 19:26 Oct 22, 2002 Andre Engels deleted "Red River (of the South)" (\"fgdfgdfgsfdsdfsfdsfdgsfdgsdfgsdfgsfdgsdfgsfdgsdfdfgffsfgsfdsfggsffgfdgsdfgsfgsfgsfgf\")
- 18:17 Oct 22, 2002 Isis deleted "Image:Janegrey.jpg" (misspelled name)
- 13:14 Oct 22, 2002 Isis deleted "Matrix(Mathematics)" (it was an error, should have had a space, the article is on the right page)
- 08:38 Oct 22, 2002 PierreAbbat deleted "Grauspitze" (non-article by 62.254.203.161: \"we want some pictures and ways to get up to the top of the peak,please help us!!!\")
- 08:07 Oct 22, 2002 Jheijmans deleted "James Richard Cross" (empty, prev \"Put your text for the new page here. he rules\")
- 08:06 Oct 22, 2002 Jheijmans deleted "Governor-General's Award for Creative Non-Fiction" (empty, prev \"\" Famous People\")
- 08:06 Oct 22, 2002 Jheijmans deleted "2196" (empty, prev \"Alex R. arrived to receive his punishment after he was captured by jeung san do authorities in 1996 and tempoted forward in time to 2196.\")
- 08:06 Oct 22, 2002 Jheijmans deleted "Hegemon" (empty, prev \"meh\")
- 08:06 Oct 22, 2002 Jheijmans deleted "Knuths up-arrow notation" (\"Uh, what is this?\")
- 08:05 Oct 22, 2002 Jheijmans deleted "Sparks, Nevada" (\"Sparks is a city in Nevada that borders Reno.\")
- 08:04 Oct 22, 2002 Jheijmans deleted "Talk:OMW" (talk of deleted page)
- 08:03 Oct 22, 2002 Jheijmans deleted "OMW" (commercial crap in Spanish)
- 05:39 Oct 22, 2002 Maveric149 deleted "Dispatcher" (This is a window )
- 05:07 Oct 22, 2002 Maveric149 deleted "Munich" (getting this out of the way for yet another move back )
- 04:47 Oct 22, 2002 Brion VIBBER deleted "Talk:Christopher Columbus" (Need to delete to put actual talk page with its history back in place)
- 04:42 Oct 22, 2002 Brion VIBBER deleted "Christopher Columbus" (No history; need to remove to put the real article back from accidentally misspelled title)
- 03:25 Oct 22, 2002 Karen Johnson deleted "Gerdy The Dinosaur" (Lir made it, and Lir wanted it deleted)
- 00:16 Oct 22, 2002 PierreAbbat deleted "Hab Theory" (just a weblink, by 12.224.24.9)
- 00:04 Oct 22, 2002 PierreAbbat deleted "Drez" (by 200.52.162.1, just a weblink)
- 20:51 Oct 21, 2002 Tarquin deleted "Chronicle of a Death Foretold" (junk entry)
- 18:18 Oct 21, 2002 Jheijmans deleted "Talk:List of famous people who had sex with animals" (moved to meta)
- 18:18 Oct 21, 2002 Jheijmans deleted "Talk:Benjamin Netanyahu On Terrorism" (moved to meta)
- 18:17 Oct 21, 2002 Jheijmans deleted "Talk:Viral meme" (contents moved to meta)
- 18:14 Oct 21, 2002 Jheijmans deleted "39/Smooth" (copyright violation)
- 18:14 Oct 21, 2002 Jheijmans deleted "Kerplunk" (copyright violation)
- 18:14 Oct 21, 2002 Jheijmans deleted "Alice Cooper" (copyright violation)
- 18:14 Oct 21, 2002 Jheijmans deleted "PLATO game Spasim" (copyright violation)
- 18:13 Oct 21, 2002 Jheijmans deleted "Hermann Koehl" (copyright violation)
- 18:13 Oct 21, 2002 Jheijmans deleted "Hawkwind/Quark, Strangeness and Charm" (personal review)
- 18:11 Oct 21, 2002 Jheijmans deleted "Alexander Girard" (copyright violation)
- 18:09 Oct 21, 2002 Jheijmans deleted "George Nelson" (copyright violation)
- 18:09 Oct 21, 2002 Jheijmans deleted "Ray Ozzie" (copyright violation)
- 18:09 Oct 21, 2002 Jheijmans deleted "Herman Miller" (copyright violation)
- 18:09 Oct 21, 2002 Jheijmans deleted "Gilbert Rohde" (copyright violation)
- 18:09 Oct 21, 2002 Jheijmans deleted "Charles and Ray Eames" (copyright violation)
- 18:09 Oct 21, 2002 Jheijmans deleted "Isamu Noguchi" (copyright violation)
- 18:08 Oct 21, 2002 Jheijmans deleted "Gary Barwin" (copyright violation)
- 18:07 Oct 21, 2002 Jheijmans deleted "El Elote" (\"ES UN PERRON PARA EL RAP MEXICANO, UNA MEXCLA ENTRE VARIOS ESTILOS GANSTA Y HIP HOP Y ALGO DE RAGGA.\")
- 18:06 Oct 21, 2002 Jheijmans deleted "Slaughterhouse Five" (\"SLAUGHTERHOUSE-FIVE or The Children\'s Crusade (a duty-dance with death) + contents\")
- 18:06 Oct 21, 2002 Jheijmans deleted "IHTFP" (\"IHTFP means I Hate This F***ing Place. It is the popular motto of students who attend MIT\")
- 18:02 Oct 21, 2002 Jheijmans deleted "Anthony M. Buzzelli" (\"please update link to http://home.cogeco.ca/~abuzzelli/\")
- 18:02 Oct 21, 2002 Jheijmans deleted "The weather in London" (\"Actually this page does exist. (etc)\")
- 18:00 Oct 21, 2002 Jheijmans deleted "East of Eden" (\"Alyssa loves Taylor\")
- 17:02 Oct 21, 2002 Jheijmans deleted "Bergen, Netherlands" (deleting incorrect page, created by me today)
- 16:11 Oct 21, 2002 Maveric149 deleted "Munich" (getting this page out of the way for a move back)
- 13:06 Oct 21, 2002 Karen Johnson deleted "Motorola 68012" (newbie experiment)
- 12:03 Oct 21, 2002 Jheijmans deleted "Frederic Rzewski" (\"Surprisingly, an American composer.\")
- 12:02 Oct 21, 2002 Jheijmans deleted "Platonic dialogues" (\"socratic irony\")
- 12:02 Oct 21, 2002 Jheijmans deleted "Larry Brown" (empty, prev \"lalalala etc.\")
- 11:58 Oct 21, 2002 PierreAbbat deleted "KWOC" (irrelevancy by 163.117.53.82: \"el cochecito de color rojo vino por la carrtera de Boadilla\")
- 07:02 Oct 21, 2002 Maveric149 deleted "Hybrid monolithic kernel" (Put your text for the new page here.rtrete )
- 07:02 Oct 21, 2002 Maveric149 deleted "Bus mastering" (Bus mastering )
- 05:36 Oct 21, 2002 Maveric149 deleted "Tungsten/Temp" (Temp page used only for conversion)
- 04:40 Oct 21, 2002 Maveric149 deleted "Middle German" (hello )
- 04:36 Oct 21, 2002 Maveric149 deleted "Dave Farrel" (dave is a ferrell slut )
- 02:30 Oct 21, 2002 Brion VIBBER deleted "Xu language" (Non-article; no history, entire contents \"Hi my name is meri\")
- 02:22 Oct 21, 2002 Maveric149 deleted "Talk:Omagh bombing" (just a heated comment ; removed by request from the person who wrote it)
- 22:16 Oct 20, 2002 Jheijmans deleted "Hygroscopic" (\"Hygroscopic substances readily absorb water.\")
- 22:16 Oct 20, 2002 Jheijmans deleted "Andrew Hartzell" (\"- One of many Midcoast and SPNC founders.\")
- 22:15 Oct 20, 2002 Jheijmans deleted "Rodney Moore" (\"Put your text for the new page here.\")
- 22:15 Oct 20, 2002 Jheijmans deleted "Oyster" (\"See also: How to cook oysters\")
- 22:14 Oct 20, 2002 Jheijmans deleted "Turbulence" (\"Disturbance in the fluid motion.\")
- 22:14 Oct 20, 2002 Jheijmans deleted "Langjökull" (\"Langjökull, size 1.021 sq.kms.\")
- 22:14 Oct 20, 2002 Jheijmans deleted "Hofsjökull" (\"Hofsjökull, size 994 sq.kms.\")
- 22:13 Oct 20, 2002 Jheijmans deleted "Vatnajökull" (\"Vatnajökull, size 8.456 sq.kms\")
- 22:13 Oct 20, 2002 Jheijmans deleted "Absurd" (Essay moved to m:absurd)
- 22:13 Oct 20, 2002 Jheijmans deleted "Auguste Comte" (empty, prev \"Put your text for the new page here. HEy Ya\'all!!! What\'s kickin???\")
- 22:13 Oct 20, 2002 Jheijmans deleted "King Bowser Koopa" (empty, prev \"Redirect to Bowser.\")
- 22:13 Oct 20, 2002 Jheijmans deleted "Transylvanian Saxon" (empty, prev \"hello, how are you?\")
- 22:12 Oct 20, 2002 Jheijmans deleted "Mercury-in-glass thermometer" (\"GAY SHIT U R\")
- 22:12 Oct 20, 2002 Jheijmans deleted "Top-down design" (empty, \"Put your text for the new page here. ghghggg hjkhjk\")
- 22:11 Oct 20, 2002 Jheijmans deleted "Kid" (delete requested by Rlee0001)
- 22:10 Oct 20, 2002 Jheijmans deleted "Nikolay Nikolaevich Semenov" (empty, prev \"He was one bitch ass Russian.\")
- 14:35 Oct 20, 2002 Tarquin deleted "Spatial tense" (empty, no content in history)
- 13:13 Oct 20, 2002 PierreAbbat deleted "Habib Bourguiba" (junk by 193.194.75.6: \"hassal maaneh!\")
- 13:12 Oct 20, 2002 PierreAbbat deleted "Talk:Laura Welch Bush" (irrelevancy by 193.194.75.6: \"do not smok to match salem cig smok can dam your healt a tortoise.\")
- 13:10 Oct 20, 2002 PierreAbbat deleted "Adelbert von Chamisso" (nonsense by 193.194.75.6: \"chimia\")
- 13:10 Oct 20, 2002 PierreAbbat deleted "Derg" (junk by 193.194.75.6: \"la griffe d\'or\")
- 07:42 Oct 20, 2002 Maveric149 deleted "Fritz Perls" (Fritz Perl, great guy )
- 04:32 Oct 20, 2002 Maveric149 deleted "Tantalum/Temp" (Temp page used only for conversion)
- 02:32 Oct 20, 2002 The Epopt deleted "List of articles not about philosophy" (no content, no history)
- 02:30 Oct 20, 2002 The Epopt deleted "Category experiment" (no content, no history, no nothing nohow)
- 20:49 Oct 19, 2002 Jheijmans deleted "Carlow" (redirect to non-existing page)
- 20:49 Oct 19, 2002 Jheijmans deleted "José Ferrer" (redirect to non-existing page)
- 20:49 Oct 19, 2002 Jheijmans deleted "Coal/History" (redirect to non-existing page)
- 20:49 Oct 19, 2002 Jheijmans deleted "Turkmenistan/Human rights issues" (redirect to non-existing page)
- 20:48 Oct 19, 2002 Jheijmans deleted "MeaningfulNess" (redirect to non-existing page)
- 20:48 Oct 19, 2002 Jheijmans deleted "Shepherds Bush" (redirect to non-existing page)
- 20:46 Oct 19, 2002 Jheijmans deleted "Italian Communist Party" (redirect to non-existing page)
- 20:46 Oct 19, 2002 Jheijmans deleted "Fundamental dimensions/Comments" (redirect to non-existing page)
- 20:46 Oct 19, 2002 Jheijmans deleted "Monaghan" (redirect to non-existing page)
- 20:46 Oct 19, 2002 Jheijmans deleted "The Hanged Man" (redirect to non-existing page)
- 20:46 Oct 19, 2002 Jheijmans deleted "Go proverb" (redirect to non-existing page)
- 20:45 Oct 19, 2002 Jheijmans deleted "Mike Dill/My ideas on socital change and terrorism" (redirect to non-existing page)
- 20:44 Oct 19, 2002 Jheijmans deleted "Cavan" (redirect to non-existing page)
- 20:44 Oct 19, 2002 Jheijmans deleted "McMahon Act" (redirect to non-existing page)
- 20:43 Oct 19, 2002 Jheijmans deleted "Writ of Certiorari" (redirect to non-existing page)
- 20:43 Oct 19, 2002 Jheijmans deleted "Sanguozhi" (redirect to non-existing page)
- 20:42 Oct 19, 2002 Jheijmans deleted "NAGPRA" (redirect to non-existing page)
- 20:42 Oct 19, 2002 Jheijmans deleted "Ozarks" (redirect to non-existing page)
- 20:42 Oct 19, 2002 Jheijmans deleted "James Barrie" (redirect to non-existing page)
- 20:41 Oct 19, 2002 Jheijmans deleted "Fuller Seminary" (redirect to non-existing page)
- 20:41 Oct 19, 2002 Jheijmans deleted "Erichtheus" (redirect to non-existing page)
- 20:41 Oct 19, 2002 Jheijmans deleted "Human rights abuses" (redirect to non-existing page)
- 20:40 Oct 19, 2002 Jheijmans deleted "C-47 Dakota" (redirect to non-existing page)
- 20:39 Oct 19, 2002 Jheijmans deleted "C-47 Gooney Bird" (redirect to non-existing page)
- 20:11 Oct 19, 2002 Jheijmans deleted "NormanWerner" (personal page with only e-mail addresses and nonsense)
- 20:08 Oct 19, 2002 Jheijmans deleted "Propaganda/Slogans" (\"terrell ate danee out \")
- 20:07 Oct 19, 2002 Jheijmans deleted "Reel-to-Reel" (Put your text for the new page here. red apple )
- 20:01 Oct 19, 2002 Jheijmans deleted "Microdot" (empty, prev \"Alabama \")
- 20:00 Oct 19, 2002 Jheijmans deleted "CPM-86" (empty, prev \" YOU SUCK!\" (in H1-tags))
- 20:00 Oct 19, 2002 Jheijmans deleted "Talk:Millinery" (talk of removed page)
- 20:00 Oct 19, 2002 Jheijmans deleted "Millinery" (empty \"this is strange very strange so strange it is beyond human means to describe the strangeness strange strange it is strange and that is the truth\")
- 20:00 Oct 19, 2002 Jheijmans deleted "2205 BC" (empty, prev \"1000000000000000000000000000000000000000000000000000000 \")
- 19:59 Oct 19, 2002 Jheijmans deleted "Mikrophunk" (empty, prev \"los chilangos que estan sonando mas duro...... \")
- 19:59 Oct 19, 2002 Jheijmans deleted "Gundobad" (empty, prev \"Gundobada \")
- 19:59 Oct 19, 2002 Jheijmans deleted "Best-first search" (empty, prev \"Put your text for the new page here. ok \")
- 19:58 Oct 19, 2002 Jheijmans deleted "Talk:Philip III of Spain" (talk of removed page)
- 19:58 Oct 19, 2002 Jheijmans deleted "Philip III of Spain" (empty, prev \" Ate peaches for fun. I love peaches. Look at these! They are peaches. \" )
- 19:58 Oct 19, 2002 Jheijmans deleted "Ferdinand I, Holy Roman Emperor" (empty, prev \"Go to the pep rally with Ferdinand I. \")
- 19:55 Oct 19, 2002 Jheijmans deleted "Jun Fan" (empty, prev \"Put your text for the new page here. jjiilkl \" )
- 18:01 Oct 19, 2002 Maveric149 deleted "Siemens Nixdorf Informationssysteme AG" (sdfg)
- 17:38 Oct 19, 2002 Maveric149 deleted "Liaotung Peninsula" (Put your text for the new page here. liaotung peninsula is cool )
- 16:29 Oct 19, 2002 PierreAbbat deleted "Image:Test.phtml" (also only says \"<? phpinfo() ?>\")
- 16:25 Oct 19, 2002 PierreAbbat deleted "Image:Test.php" (orphan file uploaded by Testtest; only text \"<? phpinfo() ?>\")
- 16:17 Oct 19, 2002 PierreAbbat deleted "Image:PrattProfile1edit.txt" (More Javascript by Jokerman)
- 16:15 Oct 19, 2002 PierreAbbat deleted "Image:PrattProfile1.txt" (HTML with Javascript uploaded by known junk uploader Jokerman9001)
- 13:35 Oct 19, 2002 Koyaanis Qatsi deleted "Image:Djmangoo-themelody.ogg" (doens\'t work, reports itself as 0 bytes)
- 13:34 Oct 19, 2002 Koyaanis Qatsi deleted "Image:SevenDayPrattProfile1.gif" (image used for HTML page with improper extension, javascript, talks about hacking computers, quotes Churchill, other random junk)
- 13:33 Oct 19, 2002 Koyaanis Qatsi deleted "Image:SevenDayPrattProfile2.gif" (image description page for image used in HTML page with improper extension, javascript, talks about hacking computers, quotes Churchill, other random junk)
- 13:33 Oct 19, 2002 Koyaanis Qatsi deleted "Image:SevenDayPrattProfile2.gif" (image used in HTML page with improper extension, javascript, talks about hacking computers, quotes Churchill, other random junk)
- 13:32 Oct 19, 2002 Koyaanis Qatsi deleted "Image:PrattProfile1.txt" (HTML page with improper extension, javascript, talks about hacking computers, quotes Churchill, other random junk)
- 13:32 Oct 19, 2002 Koyaanis Qatsi deleted "Image:PrattProfile1edit.txt" (HTML page with improper extension, javascript, talks about hacking computers, quotes Churchill, other random junk)
- 09:52 Oct 19, 2002 Karen Johnson deleted "Bobby Bonds" (garbage)
- 09:49 Oct 19, 2002 Karen Johnson deleted "Euramerica" (gibberish)
- 09:48 Oct 19, 2002 Karen Johnson deleted "Hermeneutic" (garbage)
- 09:13 Oct 19, 2002 Karen Johnson deleted "Microsoft SQL server" (garbage)
- 08:54 Oct 19, 2002 Karen Johnson deleted "Maynard James Keenan" (garbage)
- 08:27 Oct 19, 2002 Karen Johnson deleted "Macuxi" (gibberish)
- 08:25 Oct 19, 2002 Karen Johnson deleted "Padborg" (sole contents \'german speaking town\')
- 04:48 Oct 19, 2002 Koyaanis Qatsi deleted "Two Women" (hedhdhhbd\'d dfjlidshljfkdhdf sdifldfkhljh\'ssdo;shgdffffffffffffffffffffffffffhhhhhhhhhhhhhhhhh dhljfkhlfkdh;akslhf;dsjlkhafk;jhdflkjhdflkjdhflk dhfo;jkahfk;jfdhk;lfd dfhlasdjfkhlgasdjfk )
- 04:46 Oct 19, 2002 Koyaanis Qatsi deleted "A page that will never be written unless some jerk writes it" (non-encyclopedic, should be left unwritten for wikipedia:how to start a page example)
- 01:34 Oct 19, 2002 Maveric149 deleted "Hernan Cortes" (need to get this out of the way for a move)
- 01:19 Oct 19, 2002 PierreAbbat deleted "Parse tree" (test by 151.203.58.43)
- 23:30 Oct 18, 2002 PierreAbbat deleted "Newbie" (Vandalism by 203.166.96.234, now blocked. Only text \"UP YOURS! NIGGER!\".)
- 22:19 Oct 18, 2002 Maveric149 deleted "Canadian Alliance" (Getting this out of the way for a correct move)
- 22:05 Oct 18, 2002 Maveric149 deleted "Thirteen Years' War" (Getting this out of the way for a correct move)
- 21:18 Oct 18, 2002 Ed Poor deleted "Univeristy of California, Berkeley" (misspelling, nothing links here)
- 20:46 Oct 18, 2002 Lee Daniel Crocker deleted "Max Stirner" (Preparing for move)
- 18:52 Oct 18, 2002 Maveric149 deleted "Hawker Hunter" (hawker hunter )
- 11:34 Oct 18, 2002 Karen Johnson deleted "Lindau" (garbage)
- 11:33 Oct 18, 2002 Karen Johnson deleted "Ruma" (gibberish)
- 11:32 Oct 18, 2002 Karen Johnson deleted "KDD" (gibberish)
- 11:31 Oct 18, 2002 Karen Johnson deleted "Law of conservation of matter" (garbage)
- 10:38 Oct 18, 2002 PierreAbbat deleted "Asymmetric cryptography" (garbage by 193.1.206.62: \"Put your text for the new page here. hi ya mary knkjoj\")
- 03:43 Oct 18, 2002 PierreAbbat deleted "Battle of Eylau" (nonsense by 205.188.208.40: \"hi this was a great aritiv\")
- 00:03 Oct 18, 2002 PierreAbbat deleted "My" (garbage article by 12.39.89.31)
- 23:03 Oct 17, 2002 Andre Engels deleted "Chilomonas" (Full text: \"Stuff happens! Hey there Fhqwhgads! Hey there Fh-qw-h-gads! Everybody to the limit!\")
- 22:30 Oct 17, 2002 PierreAbbat deleted "2208" (nonsense prediction by 209.107.95.230)
- 22:28 Oct 17, 2002 PierreAbbat deleted "Water wheel" (newbie calling attention to a typo in Pelton; fixed)
- 22:25 Oct 17, 2002 PierreAbbat deleted "ASF" (question from 141.155.124.102: \"What is an ASF file?\" Beats me; someone sent me one and I have no idea what to read it with.)
- 18:23 Oct 17, 2002 Maveric149 deleted "Goedel's completeness theorem" (need to get this out of the way for a more -- nothing but a redirect, no content in history)
- 13:51 Oct 17, 2002 Andre Engels deleted "Soon" (nonsense; moved to \"Bad Jokes etc.\")
- 12:34 Oct 17, 2002 Andre Engels deleted "First Crusade" (redirect without history; making place for a move)
- 12:00 Oct 17, 2002 Stephen Gilbert deleted "Wardian case" (created by a bug, it seems)
- 01:51 Oct 17, 2002 PierreAbbat deleted "Christian Dior" (nonsense by 203.108.4.66: \"Put your text for the new page here. ytytyrt\")
- 01:49 Oct 17, 2002 PierreAbbat deleted "Hybrid monolithic kernel" (garbage by 64.48.234.45: \"Put your text for the new page here. tonima ,,h\")
- 01:15 Oct 17, 2002 Stephen Gilbert deleted "Turn-based game" (\"put the text for the new page here\" plus a newbie test)
- 01:15 Oct 17, 2002 Stephen Gilbert deleted "Alain Mimoun" (\"Put the text for the new page here\" plus a newbie test)
- 22:09 Oct 16, 2002 PierreAbbat deleted "Screen Actors Guild" (newbie experiment by 205.188.209.171: only text \"weeeeeeeee\")
- 22:08 Oct 16, 2002 PierreAbbat deleted "Middle-Earth Roleplaying System" (newbie experiment by 12.19.140.49: only text \"what the heck?\")
- 19:46 Oct 16, 2002 Tarquin deleted "Conspicuous consumption" (junk entry. see my suggestion on the mailing list!)
- 15:53 Oct 16, 2002 Andre Engels deleted "Talk:Scientific mythology" (redirect without history; making place for a move)
- 15:53 Oct 16, 2002 Andre Engels deleted "Talk:Scientific mythology" (redirect without history; making place for a move)
- 15:52 Oct 16, 2002 Andre Engels deleted "Scientific mythology" (redirect without history; making place for a move)
- 15:48 Oct 16, 2002 Tarquin deleted "Blue Nile" (junk entry)
- 15:33 Oct 16, 2002 Andre Engels deleted "Talk:Hayden Christiansen" (\"His name is Christensen, not Christiansen\" - page has now been moved)
- 15:27 Oct 16, 2002 Andre Engels deleted "Talk:Millions of worthless articles" (talk page to deleted page)
- 15:22 Oct 16, 2002 Andre Engels deleted "Talk:Friends United Meeting" (talk page to deleted page)
- 15:10 Oct 16, 2002 Andre Engels deleted "Talk:Q Codes" (\"his page can be deleted now that I have changed the referring links to point to Q Code.\" - subject page is a redirect to Q Code, which means this talk has been dealt with adequately)
- 11:53 Oct 16, 2002 PierreAbbat deleted "Thivai" (junk by 202.67.64.154: \"thivai is cool!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!\")
- 11:40 Oct 16, 2002 PierreAbbat deleted "Travels With Charley" (garbage by 152.163.189.170: long string of \'n\' and \'o\')
- 11:38 Oct 16, 2002 PierreAbbat deleted "Problem domain" (newbie experiment by 144.16.64.4: only text \"public range\")
- 11:22 Oct 16, 2002 Andre Engels deleted "John Forbes Nash" (redirect without history; making place for a move)
- 10:43 Oct 16, 2002 Jheijmans deleted "The Oresteia" (\"Classic depiction of the battle with Persia featuring Cassandra.\")
- 10:43 Oct 16, 2002 Jheijmans deleted "Business management" (\"The activity of managing a commercial enterprise or business.\")
- 10:42 Oct 16, 2002 Jheijmans deleted "Ray Gillen" (\"Recorded Eternal Idol, which was rerecorded with Tony Martin.\")
- 09:35 Oct 16, 2002 Andre Engels deleted "Image:German flag 1815.png" (Duplicate of Germany_flag_1815.png ; deletion requested by uploader)
- 09:33 Oct 16, 2002 Andre Engels deleted "Xenon/Temp" (Temp page; contents have already been moved to the main article)
- 08:09 Oct 16, 2002 Sjc deleted "Amatol" (Random garbage)
- 06:47 Oct 16, 2002 Jheijmans deleted "Akron, Ohio" (\"This is a specially made toilet located in ohio\")
- 06:47 Oct 16, 2002 Jheijmans deleted "Penal code" (\"Put your text for the new page here. ca\")
- 06:47 Oct 16, 2002 Jheijmans deleted "Superstring" (\"super strings!!!\")
- 06:47 Oct 16, 2002 Jheijmans deleted "Unified field theory" (empty, prev \"asdf\")
- 06:46 Oct 16, 2002 Jheijmans deleted "Other LZ compression methods" (\"u can u see u hepl\")
- 06:46 Oct 16, 2002 Jheijmans deleted "Bizarro" (empty, prev \"Put your text for the new page here. hjkhjkhj\")
- 06:46 Oct 16, 2002 Jheijmans deleted "Ear piercing" (empty, prev \"Put your text for the new page here. trtrtrtrtrtrtr\")
- 05:59 Oct 16, 2002 Sjc deleted "Flying Wedge" (Another joke: this is about ATMs and has nothing to do with the famous All Black Flying Wedge)
- 05:57 Oct 16, 2002 Sjc deleted "AEW" (A joke page: not even remotely worthy of redemption)
- 02:47 Oct 16, 2002 PierreAbbat deleted "Homeric Hymns" (garbage by 66.69.208.90: \"what did he want\")
- 02:46 Oct 16, 2002 PierreAbbat deleted "Pisistratos" (garbage by 66.69.208.90: \"Haha if your reading this you suck :P\")
- 01:19 Oct 16, 2002 Maveric149 deleted "Sweet Home Alabama (movie)" (t was good!!!!!!!!!!!!!!!!!!!! )
- 01:05 Oct 16, 2002 Maveric149 deleted "USS Valley" (redirect to non-existant page)
- 00:14 Oct 16, 2002 PierreAbbat deleted "Jay Warren" (nonsense by 212.253.158.230: \"Put your text for the new page here.www.expage.com/thaumaturgy\")
- 00:12 Oct 16, 2002 PierreAbbat deleted "Mustique" (non-article by 194.238.50.52: \"Mustique is the most amasing pkace i have evr been to it\'s so fantastic it\'s unreal.\")
- 22:56 Oct 15, 2002 Maveric149 deleted "Egg cell" (Put your text for the new page here. )
- 22:53 Oct 15, 2002 Jheijmans deleted "Ciutat Vella" (empty, prev \"Barri del casc antic de barcelona.\")
- 22:49 Oct 15, 2002 Jheijmans deleted "Like nailing jelly to a tree" (orphan from jargon file \"Like nailing jelly to a tree\")
- 22:48 Oct 15, 2002 Jheijmans deleted "Like kicking dead whales down the beach" (orphan from jargon file \"Like kicking dead whales down the beach is a phrase used to describe a slow, difficult, and disgusting process. It was first popularized by a famous quote about the difficulty of getting work done under one of IBM\'s mainframe operating systems. \"Well, you could write a C compiler in COBOL, but it would be like kicking dead whales down the beach.\" See also fear and loathing.\")
- 22:16 Oct 15, 2002 Jheijmans deleted "James Batcheller Sumner" (empty, prev \"ok\")
- 22:16 Oct 15, 2002 Jheijmans deleted "MC Det" (\"you silly cunt dont try to test me ill av u shoot get some new style\")
- 22:06 Oct 15, 2002 Jheijmans deleted "New England boiled dinner" (empty, prev \"fag\")
- 22:06 Oct 15, 2002 Jheijmans deleted "1208 BC" (empty, prev \"Put your text for the new page here. hey babe\")
- 22:06 Oct 15, 2002 Jheijmans deleted "WikiProject Biology" (\"bitch\")
- 22:05 Oct 15, 2002 Jheijmans deleted "Abelian variety" (\"Dude!\")
- 22:05 Oct 15, 2002 Jheijmans deleted "Cassette" (\"STORAGE DEVICES\")
- 22:04 Oct 15, 2002 Jheijmans deleted "DBA" (\"Database Administrator\")
- 22:04 Oct 15, 2002 Jheijmans deleted "Application layer" (\"what is this all about\")
- 22:04 Oct 15, 2002 Jheijmans deleted "Vacation" (\"Time off work. A holiday.\")
- 22:04 Oct 15, 2002 Jheijmans deleted "Caledonia" (\"(Latin name for:) Scotland\")
- 22:03 Oct 15, 2002 Jheijmans deleted "Lamp" (\"Lamp. Typically a deskside light source\")
- 22:03 Oct 15, 2002 Jheijmans deleted "Talk:Status" (talk of deleted page)
- 22:03 Oct 15, 2002 Jheijmans deleted "Status" (wikipedia is not a dictionary)
- 22:02 Oct 15, 2002 Jheijmans deleted "Mathematics Magazine" (\"pok\")
- 22:02 Oct 15, 2002 Jheijmans deleted "Rangefinder cameras" (\"hi my name is bob. :)\")
- 22:02 Oct 15, 2002 Jheijmans deleted "Copy protection" (empty, prev \"Put your text for the new page here. go next\")
- 22:02 Oct 15, 2002 Jheijmans deleted "Other LZ compression methods" (empty creation)
- 22:01 Oct 15, 2002 Maveric149 deleted "Laccolith" (\"fuck u alll i hate scince \" Apparently you didn\'t care for English class either)
- 19:37 Oct 15, 2002 Brion VIBBER deleted "Microsoft Windows 2.0" (Non-article; only content \"Where i can download Windows 1.0 and windows 2.0 please send me link tapster@wp.pl thx\")
- 18:59 Oct 15, 2002 Stephen Gilbert deleted "Talk:Put" (article page deleted; no useful content)
- 18:58 Oct 15, 2002 Stephen Gilbert deleted "SPIHT" (newbie experiment; deletion requested)
- 18:57 Oct 15, 2002 Stephen Gilbert deleted "Put" (copyright violation; requested deletion)
- 18:57 Oct 15, 2002 Stephen Gilbert deleted "Marcel Petiot" (copyright violation; requested deletion)
- 18:57 Oct 15, 2002 Stephen Gilbert deleted "WSDL" (copyright violation; requested deletion)
- 18:28 Oct 15, 2002 Magnus Manske deleted "Ländervorwahlen/nachNummern" (Says \"0041 Switzerland 0049 Germany\")
- 18:26 Oct 15, 2002 Tarquin deleted "User:ZxAnPhOrIaN/StateReportSites" (by request of user)
- 18:00 Oct 15, 2002 Scipius deleted "Jean Renoir" (Full text: \"bum\")
- 14:48 Oct 15, 2002 Tarquin deleted "Cretinous" (more jargon file stuff. not a fictionary, etc)
- 14:44 Oct 15, 2002 Tarquin deleted "Brain-damaged" (please could we stop importing dross from the jargon file?)
- 13:10 Oct 15, 2002 Tarquin deleted "Calculus/chain rule" (fixed links to this page. The full article is at Chain rule)
- 12:29 Oct 15, 2002 Tarquin deleted "Prime number/Talk" (just junk)
- 10:16 Oct 15, 2002 Jheijmans deleted "Slovenia/Temp" (temporary page)
- 06:42 Oct 15, 2002 Jheijmans deleted "USS Lake" (\"The correct name of this ship is USS Lake Champlain.\")
- 06:41 Oct 15, 2002 Jheijmans deleted "USS Philippine" (\"The correct name of this ship is USS Philippine Sea.\")
- 06:41 Oct 15, 2002 Jheijmans deleted "USS Bunker" (\"The correct name of this ship is USS Bunker Hill.\")
- 06:40 Oct 15, 2002 Jheijmans deleted "USS San" (\"The correct name of this ship is USS San Jacinto.\")
- 06:40 Oct 15, 2002 Jheijmans deleted "USS Leyte" (\"The correct name of this ship is USS Leyte Gulf.\")
- 06:40 Oct 15, 2002 Jheijmans deleted "USS Coral" (\"The correct name of this ship is USS Coral Sea\")
- 06:40 Oct 15, 2002 Jheijmans deleted "USS Belleau" (\"Correct name of this ship is USS Belleau Wood\")
- 06:09 Oct 15, 2002 Karen Johnson deleted "USS Franklin" (blank)
- 02:02 Oct 15, 2002 Karen Johnson deleted "Brown Deer, Wisconsin" (garbage)
- 02:01 Oct 15, 2002 Karen Johnson deleted "4004 BC" (irrelevant url)
- 02:01 Oct 15, 2002 Karen Johnson deleted "Jacques Cossette-Trudel" (swearing in french)
- 02:00 Oct 15, 2002 Karen Johnson deleted "University of Wisconsin, Stout" (irrelevancy)
- 01:59 Oct 15, 2002 Karen Johnson deleted "Jangyn Bridge" (\'hi\')
- 01:59 Oct 15, 2002 Karen Johnson deleted "Poissy" (blank)
- 01:59 Oct 15, 2002 Karen Johnson deleted "Talk:Poissy" (irrelevant & article is being deleted (1 sentence only))
- 01:58 Oct 15, 2002 Karen Johnson deleted "Xerox 1108" (experiment)
- 01:57 Oct 15, 2002 Karen Johnson deleted "Data vector" (totally irrelevant paragraph)
- 01:55 Oct 15, 2002 Karen Johnson deleted "Danville, Kentucky" (obscenity)
- 22:15 Oct 14, 2002 Jheijmans deleted "Bosnian language" (empty, previously \"thank you \")
- 21:57 Oct 14, 2002 Scipius deleted "Electric battery" (Full text: \"I like turtles. They are round. \" Indeed.)
- 21:44 Oct 14, 2002 Scipius deleted "Talk:Germany/Temp" (/Temp page no longer necessary)
- 21:43 Oct 14, 2002 Scipius deleted "Germany/Temp" (/Temp page no longer necessary)
- 21:13 Oct 14, 2002 Jheijmans deleted "Erasmus" (needed for move, no history but \"conversion script\")
- 21:00 Oct 14, 2002 PierreAbbat deleted "General Federation of Jewish Labour" (newbie experiment by 12.236.210.167: only content \"Oh\")
- 16:35 Oct 14, 2002 Jheijmans deleted "Liudolf of Swabia" (only genealogical information (\"Eldest son of Otto I the Great and his first wife, Eadgyth.\"), orphan (only linked from talk page))
- 16:33 Oct 14, 2002 Jheijmans deleted "Quay" (Wikipedia is not a dictionary)
- 16:30 Oct 14, 2002 Jheijmans deleted "Emma Bunton" (empty, previous two types of vandalism, last \"jander jander jander\")
- 16:30 Oct 14, 2002 Jheijmans deleted "Pavel Chekov" (empty, prev \"He is shite\")
- 12:26 Oct 14, 2002 Brion VIBBER deleted "TWA 847 hijacking" (Only content \"cool terrorist actions. 88\"; no history; by known vandal 24.201.235.57)
- 11:58 Oct 14, 2002 PierreAbbat deleted "U.S. presidential election, 2012" (too far in the future to say anything)
- 09:31 Oct 14, 2002 Maveric149 deleted "Route inspection problem" (Put your text for the new page here. gdgdfgdfgdfgdfgd )
- 08:55 Oct 14, 2002 Maveric149 deleted "Popper" (junk; moved to bad jokes)
- 07:56 Oct 14, 2002 Magnus Manske deleted "Henk Rogers" (Says \"A person.\")
- 07:49 Oct 14, 2002 Jheijmans deleted "Ani Yuntikwalaski" (copyright violation, been on votes for deletion for a while)
- 07:48 Oct 14, 2002 Jheijmans deleted "Zulch, Evan" (redirect to deleted page)
- 07:48 Oct 14, 2002 Jheijmans deleted "Evan Zulch" (empty page)
- 07:46 Oct 14, 2002 Jheijmans deleted "Sandra Dempsey" (\"Put your text for the new page here.\")
- 07:45 Oct 14, 2002 Jheijmans deleted "Cassiodorus" (\"Put your text for the new page here. id questions for the history class\")
- 07:45 Oct 14, 2002 Jheijmans deleted "Daniel Vettori" (\"Put your text for the new page here. yes yes yes\")
- 07:44 Oct 14, 2002 Jheijmans deleted "El Lissitzky" (\"he was a great man\")
- 07:44 Oct 14, 2002 Jheijmans deleted "Text to speech" (\"New Text\")
- 07:44 Oct 14, 2002 Jheijmans deleted "Natural language generation" (\"New Text\")
- 07:44 Oct 14, 2002 Jheijmans deleted "Program transformation" (\"Test?\")
- 06:27 Oct 14, 2002 Sjc deleted "Maclyn McCarty" (Non-page: contained only the statement: \"A nice guy^_^\")
- 04:24 Oct 14, 2002 Maveric149 deleted "2109" (Hi every body )
- 03:37 Oct 14, 2002 Maveric149 deleted "Phosphorus/Temp" (temp page that is no longer needed)
- 01:03 Oct 14, 2002 Maveric149 deleted "Law of Octaves" (kjhjhjh )
- 00:56 Oct 14, 2002 Maveric149 deleted "André Malraux" (need to get this out of the way for a correct move)
- 22:53 Oct 13, 2002 PierreAbbat deleted "Rockefeller Institute" (useless entry by 63.199.203.105: \"A very good school.\")
- 22:52 Oct 13, 2002 PierreAbbat deleted "Acrostic puzzle" (Newbie experiment by 65.29.135.209. uepnco)
- 22:50 Oct 13, 2002 Tarquin deleted "Raymon Smullyan" (typo)
- 21:19 Oct 13, 2002 Bryan Derksen deleted "Great Red Spot" (Making room for a move. This is a redirect with no history.)
- 21:14 Oct 13, 2002 Maveric149 deleted "Superscript" (Wikipedia is not a dictionary)
- 21:13 Oct 13, 2002 Maveric149 deleted "Natural order" (Wikipedia is not a dictionary)
- 21:08 Oct 13, 2002 Andre Engels deleted "Talk:Confused Deputy Problem" (talk page to deleted page)
- 21:01 Oct 13, 2002 Andre Engels deleted "Talk:Common Earth Language" (talk page to deleted page)
- 20:58 Oct 13, 2002 Andre Engels deleted "Xerox Document Company" (\"Put your text for the new page here. hgia\")
- 20:58 Oct 13, 2002 Andre Engels deleted "Nuclear pile" (\"whatevefr\")
- 17:31 Oct 13, 2002 PierreAbbat deleted "Cheddite" (nonsense by 212.7.9.35; only text \"Put your text for the new page here.ch2)3n2*hclo4)2 8 km/sec.\")
- 12:25 Oct 13, 2002 PierreAbbat deleted "Supercharger" (nonsense by 62.253.96.5; only contents \"Willy willy willy\")
- 10:32 Oct 13, 2002 Sjc deleted "Holt, England" (There are a number of Holts in England in different counties)
- 10:24 Oct 13, 2002 Jheijmans deleted "Loaded terminology" (dictionary definition)
- 09:49 Oct 13, 2002 Scipius deleted "Quercus robur- Ongoing projects & To Do list..." (Deletion of a user\'s to do list that has been moved into user space)
- 07:46 Oct 13, 2002 Sjc deleted "October 12 2002 car bomb, Kuta, Bali" (Date of event incorrect: new page similarly entitled at 11/10/2002)
- 07:04 Oct 13, 2002 Maveric149 deleted "Latin phrases" (need to get this out of the way for a correct move)
- 02:14 Oct 13, 2002 Maveric149 deleted "American Christian Zionists" (Referring to a politically Zionist agenda of American Christian Fundamentalists. ; Wikipedia is not a dictionary and this term appears to be ideosyncratic)
- 23:34 Oct 12, 2002 Scipius deleted "Curly Howard" (Full text: \"nyuk \")
- 22:20 Oct 12, 2002 Jheijmans deleted "Steamboat" (\"poop\")
- 21:41 Oct 12, 2002 Magnus Manske deleted "Redirect test page A" (REDIRECT Redirect test page B)
- 21:41 Oct 12, 2002 Magnus Manske deleted "Redirect test page C" (REDIRECT Redirect test page A)
- 21:41 Oct 12, 2002 Magnus Manske deleted "Redirect test page B" (REDIRECT Redirect test page C)
- 21:12 Oct 12, 2002 Tarquin deleted "Talk:The simpsons/dr. nick riviera" (wrong page title -- doesnt match the real article and empty)
- 20:37 Oct 12, 2002 Jheijmans deleted "Kent Keith" (\"http://www.paradoxicalcommandments.com/\")
- 20:35 Oct 12, 2002 Jheijmans deleted "FrameMaker" (empty, prev \"ut your text for the new page here. This paper seeks to assess the effectiveness of a popular grammar and style checker, Grammatik V, (etc.)\")
- 16:35 Oct 12, 2002 Andre Engels deleted "Robert Guiscard" (copyright violation; from votes for deletion)
- 15:59 Oct 12, 2002 Andre Engels deleted "SoHo, New York City, New York" (recently created orphan; deletion requested by originator)
- 15:59 Oct 12, 2002 Andre Engels deleted "Murray Hill, New York City, New York" (recently created orphan; deletion requested by originator)
- 15:58 Oct 12, 2002 Andre Engels deleted "Harlem, New York City, New York" (orphan; deletion requested by originator)
- 15:58 Oct 12, 2002 Andre Engels deleted "Greenwich Village, New York City, New York" (orphan; deletion requested by originator)
- 15:32 Oct 12, 2002 PierreAbbat deleted "List of famous people who had sex with animals" (Page by 213.122.219.144, previously deleted.)
- 14:36 Oct 12, 2002 Tarquin deleted "ZxAnPhOrIaN/StateReportSites" (moved to user space)
- 13:09 Oct 12, 2002 PierreAbbat deleted "Charles Cunningham Boycott" (garbage by 64.105.22.115: \"he was boned in 1832, and choked to death on a sandwhich in 1897.... O NO WAIT\" etc.)
- 12:10 Oct 12, 2002 Andre Engels deleted "Internet gaming" (useless stub: \"Games played on or with the aid of internet communications.\")
- 12:09 Oct 12, 2002 Andre Engels deleted "Joe Rock" (\"hey so you like... stuff\")
- 12:08 Oct 12, 2002 Andre Engels deleted "Herman Brusselmans" (empty page, previously \"Ne Klootzak die alleen maar vuilspuiterij kan schrijven over beffen en kakken\" (which is some Dutch insult to the person the page should be about))
- 12:08 Oct 12, 2002 Andre Engels deleted "Queen Anne's War" (empty page, previous text \"HEY WHATS UP EVERYONE, IF U WANT INFO, U WONT FIND ITHERE HAHAHAH\")
- 11:49 Oct 12, 2002 Karen Johnson deleted "Europrix" (garbage)
- 03:36 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (city names)" (need to get this out of the way for a move-back)
- 03:35 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (ships)" (need to get this out of the way for a move-back)
- 03:34 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (movies)" (need to get this out of the way for a move-back)
- 03:34 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (names and titles)" (need to get this out of the way for a move-back)
- 03:33 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (precision)" (need to get this out of the way for a move-back)
- 03:32 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (common names)" (need to get this out of the way for a move-back)
- 03:32 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (anglicization)" (need to get this out of the way for a move-back)
- 03:31 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (pluralization)" (need to get this out of the way for a move-back)
- 03:30 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (capitalization)" (need to get this out of the way for a move-back)
- 03:28 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (acronyms)" (need to get this out of the way for a move-back)
- 02:25 Oct 12, 2002 Karen Johnson deleted "VMWare" (vandalism)
- 02:24 Oct 12, 2002 Karen Johnson deleted "List of famous people who had sex with animals" (i seriously doubt we need this page! )
- 00:27 Oct 12, 2002 Tarquin deleted "HfTupper" (mysterious empty orphan with no history)
- 23:47 Oct 11, 2002 Andre Engels deleted "List of collective nouns by collective terms" (mis-move, moved on to Talk:List_of_collective_nouns_by_collective_term)
- 23:44 Oct 11, 2002 Andre Engels deleted "Talk:ColdWar" (empty; old contents only the (unanswered) question how pages are moved)
- 23:03 Oct 11, 2002 Andre Engels deleted "Talk:Chinese characteristics" (\"Put your text for the new page here. Gentle Bear\")
- 22:58 Oct 11, 2002 Andre Engels deleted "Talk:Queen (Chess)" (mis-move, page should have gone to Talk:Queen (chess) (and is there now))
- 22:49 Oct 11, 2002 Andre Engels deleted "Talk:Ǭç¹è§è§£" (talk page of deleted page)
- 22:38 Oct 11, 2002 Andre Engels deleted "Talk:Candy blunt" (talk to deleted page)
- 22:33 Oct 11, 2002 Andre Engels deleted "Talk:Business and Industry basic topics" (empty page, only history \"Describe the new page here\")
- 22:28 Oct 11, 2002 Andre Engels deleted "Talk:Bubi" (talk page of deleted page)
- 22:26 Oct 11, 2002 Scipius deleted "Mossel Bay" (Full text: \"Put your text for the new page here.about the of bartolamev dias \")
- 22:25 Oct 11, 2002 Scipius deleted "Georges Pompidou" (Full text: \"ÒÓÓÓÓÓÓÓÓÓÓ!!!!!!!!!!11 ÏÐÈÂÅÒÈÊÈ ÈÇ ÁÅËÀÐÓÑÈ!!!!!!!!!!!! BELARUS!!!!!!!!!!!!!!!!!!!!1 \")
- 22:24 Oct 11, 2002 Scipius deleted "Carboxyl group" (Full text: \"carboxyl\")
- 22:20 Oct 11, 2002 Andre Engels deleted "Talk:Bridge game" (only text \"see Talk:Contract bridge for a suggestion on moving this page -- Tarquin\" - outdated, since the move has already taken place)
- 22:17 Oct 11, 2002 Andre Engels deleted "Talk:Boure" (talk page to deleted page)
- 22:16 Oct 11, 2002 Andre Engels deleted "Talk:Boris the crazy Russian" (talk page to deleted page)
- 22:08 Oct 11, 2002 Andre Engels deleted "Talk:Blue-green money" (talk of deleted page)
- 22:00 Oct 11, 2002 Andre Engels deleted "Talk:Bilbo" (\"Why doesn\'t the redirect work? And shouldn\'t the article be entitled Bilbo rather than using the slash?\" - the redirect works, and there is no slash to be found anywhere)
- 21:49 Oct 11, 2002 Andre Engels deleted "Talk:Belief in God spectrum" (talk page without subject page; contents are already on meta)
- 21:41 Oct 11, 2002 Andre Engels deleted "Talk:Battle of TannenburgBattle of Grunwald" (talk of deleted page, only saying where it should be redirected)
- 21:34 Oct 11, 2002 Andre Engels deleted "Talk:Baptism of the dead" (talk page to deleted page)
- 21:33 Oct 11, 2002 Andre Engels deleted "Talk:Bantu languages" (only text \"The text from Bantu should be moved here\" (which happened ages ago); making place for a move of Talk:Bantu)
- 21:30 Oct 11, 2002 Andre Engels deleted "Talk:Baker Natalie Bachrach" (talk page without subject page)
- 18:29 Oct 11, 2002 Ed Poor deleted "Talk:List of famous people who have pierced their private parts" (Requested by Easter Bradford)
- 17:50 Oct 11, 2002 Jheijmans deleted "Victoria, Seychelles" (\"yyyyyyyyyyyyyyyyyyyyyy\")
- 11:54 Oct 11, 2002 Andre Engels deleted "Nika revolt" (copyright violation; on votes for deletion for over a week)
- 11:50 Oct 11, 2002 PierreAbbat deleted "Togidubnus" (212.23.26.209 claims to have been Togidubnus in a past life)
- 11:15 Oct 11, 2002 Karen Johnson deleted "Antonella Brugnola" (unneeded double redirect)
- 07:21 Oct 11, 2002 Jheijmans deleted "Siobhan Fahey" (\"The offical siobhan fahey website can be found at: http://www.siobhanfahey.com/\")
- 07:21 Oct 11, 2002 Jheijmans deleted "Augusta of Saxe-Gotha" (\"hey y\'all, i\'m from texas, can\'t y\'all tell? good luck with your research on Augusta of Saxe-Gotha. Now, did y\'all really expect 2 find some information on this old lady from an old texan? now i didn\'t think so!bye, luv y\'all!\")
- 07:20 Oct 11, 2002 Jheijmans deleted "Governor-General's Award for Creative Non-Fiction" (\"famous people the mccaughan\'s family Brad McCaughan Carolyn McCaughan Samantha McCaughan Gregory McCaughan Timothy McCaughan Tappy McCaughan\")
- 07:19 Oct 11, 2002 Jheijmans deleted "War of the Grand Alliance" (\"considering the fact that spain sucks, i will not write anything about this subject! GO...\")
- 07:19 Oct 11, 2002 Jheijmans deleted "William Pitt, the Younger" (\"Hi people, its bill bob joe! i luv u all!! hugs and kisses!! hope u like my page bout william pitt, the younger! hope it helps with your report!!! luv ya all\")
- 06:50 Oct 11, 2002 Jheijmans deleted "Partido dos Trabalhadores" (\"PT is a left Brazilian party.\")
- 06:49 Oct 11, 2002 Jheijmans deleted "Amazonia" (\"Amazonia Florest is Brazilian!!!!!!!\")
- 06:49 Oct 11, 2002 Jheijmans deleted "Fred Olsen" (\"http://www.fredolsen.es/lineas/english/index.htm\")
- 06:48 Oct 11, 2002 Jheijmans deleted "Talk:Autodynamics" (talk page of removed page)
- 06:48 Oct 11, 2002 Jheijmans deleted "Autodynamics" (former nonsense/poss. copyright violation)
- 06:47 Oct 11, 2002 Jheijmans deleted "DNA computer" (emptied by original author)
- 06:46 Oct 11, 2002 Jheijmans deleted "Matthew Lancelot Ryan" (emptied by Zoe)
- 05:34 Oct 11, 2002 Maveric149 deleted "Eternity" (joke; Eternity Definition: It is the moment between you come and the moment you can go home! )
- 01:49 Oct 11, 2002 PierreAbbat deleted "Toba" (khdjlkfhaslkf: Toba pagandi.)
- 01:44 Oct 11, 2002 PierreAbbat deleted "Blah" (newbie playing in sandbox)
- 01:00 Oct 11, 2002 Maveric149 deleted "Macintosh raincoat" (blank; junk in history)
- 20:49 Oct 10, 2002 Scipius deleted "Cafe wall illusion" (Full text: \"CLUB LIQUID\")
- 20:15 Oct 10, 2002 Tarquin deleted "Line segment" (just junk)
- 20:15 Oct 10, 2002 Tarquin deleted "Pembrokeshire" (just junk)
- 20:15 Oct 10, 2002 Tarquin deleted "Channel coding" (just junk)
- 18:07 Oct 10, 2002 Scipius deleted "Image:Uk flag largeupsidedown.png" (Flag no longer necessary)
- 18:04 Oct 10, 2002 Scipius deleted "Image:Waveflag.gif" (Again removed superfluous US flag)
- 16:11 Oct 10, 2002 Scipius deleted "Nixon" (Full text: \"Put your text for the new page here. crook\" (not redirected because the movie might use it))
- 12:19 Oct 10, 2002 Jheijmans deleted "Shooting at the 1936 Summer Olympics" (\"hi i amin the 9th grade doin homework for heritage 9\")
- 12:08 Oct 10, 2002 Karen Johnson deleted "Shar" (nonentry)
- 09:28 Oct 10, 2002 Jheijmans deleted "Palette" (\"Put your text for the new page here.SADSDSSSS\")
- 09:27 Oct 10, 2002 Jheijmans deleted "Executive department" (\"Put your text for the new page here.\")
- 07:00 Oct 10, 2002 Maveric149 deleted "Helium/Temp" (temp page that is no longer needed)
- 06:50 Oct 10, 2002 Robert Merkel deleted "Drexel Shaft" (joke page (content added to bad jokes and deleted nonsense))
- 06:49 Oct 10, 2002 Robert Merkel deleted "Talk:Drexel Shaft" (deleting parent page)
- 06:46 Oct 10, 2002 Jheijmans deleted "Robert Moses" (\"Put your text for the new page here.\")
- 06:46 Oct 10, 2002 Jheijmans deleted "Correspondence course" (\"master in business and administration\")
- 06:44 Oct 10, 2002 Jheijmans deleted "Discordance Axis" (\"these guys fucking rock\")
- 06:44 Oct 10, 2002 Jheijmans deleted "Frederick, Lord North" (\"Lord North was a freak!\")
- 06:44 Oct 10, 2002 Jheijmans deleted "Social Development" (\"This is whack! \")
- 06:43 Oct 10, 2002 Jheijmans deleted "Obfuscated PostScript Contest" (empty, prev \"blarg\")
- 06:43 Oct 10, 2002 Jheijmans deleted "Gungan" (empty, prev \"hello my friend my name is Jesse i am talking in wikipedia\")
- 01:19 Oct 10, 2002 PierreAbbat deleted "Pinworm" (newbie experiment by 63.226.31.222: only contents \"gay!!\")
- 00:26 Oct 10, 2002 Andre Engels deleted "Zacharias Janssen" (empty page; only former contents: \"dude\")
- 21:43 Oct 9, 2002 PierreAbbat deleted "Motnitroat" (Orphan article by 217.35.86.218 about a non-word.)
- 20:47 Oct 9, 2002 PierreAbbat deleted "Contract bridge palying technique" (orphan typo; contents have been moved to correct spelling)
- 19:54 Oct 9, 2002 Andre Engels deleted "Talk:50 kroner note" (similar to the 200 kroner note)
- 19:54 Oct 9, 2002 Andre Engels deleted "Talk:200 kroner note" (empty, and has been such for 2 1/2 months after only 13 minutes of existence with text)
- 19:48 Oct 9, 2002 Magnus Manske deleted "Topory" (Says \"Piotr Parda; Przenies sie do User: namespace, bo beda sobie robic z ciebie jaja, ze chcesz pisac artykul/ o sobie. ;-)\")
- 19:42 Oct 9, 2002 Andre Engels deleted "Talk:ATI" (talk of deleted page; only contents is the origin of the (copyright violating) information)
- 19:28 Oct 9, 2002 Ed Poor deleted "Time base" (graffiti page)
- 19:27 Oct 9, 2002 Ed Poor deleted "Staff system" (graffiti page)
- 19:27 Oct 9, 2002 Andre Engels deleted "Talk:Anthocyanins" (Only the contents of the deleted subject page, which was basically an advertisement)
- 19:26 Oct 9, 2002 Andre Engels deleted "Talk:Anomy" (empty talk page; only history \"This needs to be elaborated on\")
- 19:25 Oct 9, 2002 Andre Engels deleted "Talk:Angel/far-fetched belief" (talk of deleted page)
- 19:24 Oct 9, 2002 Andre Engels deleted "Talk:Ancient civilization" (talk about whether \'Celts\' and \'Israel\' are civilizations. Since the article is now redirecting to \'ancient history\', which does not use the term \'civilization\' at all, not of any interest)
- 19:22 Oct 9, 2002 Andre Engels deleted "Talk:Anarchy Online" (talk of deleted page, just arguing why the page should be deleted)
- 19:20 Oct 9, 2002 Andre Engels deleted "Talk:American Union of Men" (talk to deleted page)
- 19:18 Oct 9, 2002 Andre Engels deleted "Talk:Amead" (Talk to deleted page)
- 19:15 Oct 9, 2002 Andre Engels deleted "Talk:A.L.I.C.E" (Empty, has been for a long time)
- 18:57 Oct 9, 2002 Andre Engels deleted "Talk:Adek336" (talk page without subject page)
- 18:50 Oct 9, 2002 Andre Engels deleted "Talk:2002 State of the Union Address" (Talk of a page that is de facto deleted)
- 18:49 Oct 9, 2002 Andre Engels deleted "Talk:72 virgins" (talk page to deleted page)
- 18:43 Oct 9, 2002 Andre Engels deleted "Talk:23nd century" (Talk page without corresponding subject page)
- 18:39 Oct 9, 2002 Andre Engels deleted "Talk:Antiwikipedic" (moved to meta; subject page has already been deleted)
- 18:33 Oct 9, 2002 Andre Engels deleted "Painting techniques" (Just the beginning of \'Impressionism\' copied (even with the \'redirected from Impressionist\' in it))
- 18:32 Oct 9, 2002 Andre Engels deleted "Anna Moffo" (advertisement (for a biography on Anna Moffo))
- 17:49 Oct 9, 2002 Scipius deleted "Afar language" (Article talked about how Afar was causing confusion among students of Roosevelt High in Minneapolis. Nothing on the language itself, therefore junk.)
- 17:44 Oct 9, 2002 Scipius deleted "Bayer Company" (Full text: poop opium is bad 4 )
- 17:39 Oct 9, 2002 Scipius deleted "Ypres" (A bit of a test or something: Full text: Put your text for the new page here. crystal )
- 17:24 Oct 9, 2002 PierreAbbat deleted "Heian Period" (Junk by 216.231.11.130: \"no i am not goign to write stuff for u to steal\")
- 17:21 Oct 9, 2002 PierreAbbat deleted "Zhu" (junk by 216.231.11.130: \"Put your text for the new page here. ur gay and so is teh zhu dynasty casue ur not giving me any info!!!!\")
- 17:21 Oct 9, 2002 PierreAbbat deleted "Zhu" (junk by 216.231.11.130: \"Put your text for the new page here. ur gay and so is teh zhu dynasty casue ur not giving me any info!!!!\")
- 08:09 Oct 9, 2002 Andre Engels deleted "Cleisthenes" (\"Put your text for the new page here. what does it mean?\")
- 06:34 Oct 9, 2002 Jheijmans deleted "Mossel Bay" (\"Put your text for the new page here. Me Gay man\")
- 06:34 Oct 9, 2002 Jheijmans deleted "Clerks" (\"First movie by Kevin Smith.\")
- 06:34 Oct 9, 2002 Jheijmans deleted "World War II/The Blitz" (\"Help\")
- 06:33 Oct 9, 2002 Jheijmans deleted "Bridge of Sighs" (empty, prev \"sites\")
- 06:32 Oct 9, 2002 Maveric149 deleted "Syntax analysis" (pro )
- 06:07 Oct 9, 2002 Maveric149 deleted "Neon/Temp" (temp page that is no longer needed)
- 00:44 Oct 9, 2002 Maveric149 deleted "Waxhaw, South Carolina" (Put your text for the new page here. map )
- 22:31 Oct 8, 2002 Lee Daniel Crocker deleted "Natural catastrophe" (Same kid; no content or history in either page.)
- 22:30 Oct 8, 2002 Lee Daniel Crocker deleted "Ignatius Donnelly" (Just a kid playing around...)
- 21:37 Oct 8, 2002 Jheijmans deleted "Khamis Mushait" (redirect, needed for move)
- 21:35 Oct 8, 2002 Jheijmans deleted "Kleene algebra" (\"AXYZFBD AXYZFCD AXYZXYZFCD AXYZXYZFBD AXYZXYZXYZFBD AXYZXYZXYZFBD AXYZXYZXYZFBD AXYZXYZXYZFBD AXYZXYZFCD AXYZXYZFBD AXYZXYZXYZFCD AXYZXYZXYZFCD AXYZXYZXYZFCD AXYZXYZXYZFCD\")
- 21:35 Oct 8, 2002 Jheijmans deleted "Extranet" (\"Any Idea??\")
- 21:35 Oct 8, 2002 Jheijmans deleted "Young Turks" (\"Young Turks.\")
- 21:35 Oct 8, 2002 Jheijmans deleted "Motorola 68008" (\"Put your text for the new page here. gngh\")
- 21:34 Oct 8, 2002 Jheijmans deleted "Milwaukee Deep" (\"my name is rover mcrover i am in 2nd grade\")
- 21:34 Oct 8, 2002 Jheijmans deleted "Polish-Lithuanian Commonwealth" (History of Poland)
- 19:17 Oct 8, 2002 Tarquin deleted "Clifford E. Berry" (junk entry)
- 17:30 Oct 8, 2002 PierreAbbat deleted "Cockermouth" (empty orphan contained junk)
- 15:45 Oct 8, 2002 Tarquin deleted "Hiawatha" (no content)
- 15:44 Oct 8, 2002 Tarquin deleted "Mazurka" (no content)
- 10:46 Oct 8, 2002 Jheijmans deleted "Provisional Government" (empty, prev \"Gör som jag säger annars skruvar jag fast dig i bordet.\" /Jorma Hogeborn\")
- 10:37 Oct 8, 2002 Andre Engels deleted "Internet humor/Two Cows Talk" (Talk page hiding as a subpage; contents have been moved to Talk:You have two cows)
- 10:36 Oct 8, 2002 Jheijmans deleted "Romania/Temp" (temporary page)
- 10:34 Oct 8, 2002 Andre Engels deleted "Beloit College" (copyright violation; has been on Votes for deletion for a week; already taken off \'Votes for Deletion\' as an already deleted page)
- 10:31 Oct 8, 2002 Andre Engels deleted "New York City, New York/Murray Hill" (short-lived page, now only orphan redirect, deletion requested by originator)
- 10:30 Oct 8, 2002 Andre Engels deleted "New York City, New York/Harlem" (short-lived page, now only redirect, deletion requested by originator)
- 08:56 Oct 8, 2002 WojPob deleted "Motorola Coldfire" (non article, no history)
- 08:33 Oct 8, 2002 Jheijmans deleted "List of Biblical names starting with W" (\"There are no names in the Bible that start with W.\")
- 08:32 Oct 8, 2002 Jheijmans deleted "List of Biblical names starting with X" (\"There are no names in the Bible that start with X\")
- 08:31 Oct 8, 2002 Jheijmans deleted "Sympathomimetic" (\"Put your text for the new page here.theobromine\")
- 08:28 Oct 8, 2002 Jheijmans deleted "Talk:OsmosisTwo" (talk page of removed page)
- 08:28 Oct 8, 2002 Jheijmans deleted "OsmosisTwo" (nonsense page, listed on votes for deletion for some time)
- 08:27 Oct 8, 2002 Jheijmans deleted "Protea" (copyright violation, been on votes for deletion for some time)
- 08:26 Oct 8, 2002 Jheijmans deleted "Teunis de Wit" (personal page, listed on votes for deletion for some time)
- 08:26 Oct 8, 2002 Jheijmans deleted "Talk:John T. Thompson" (talk page of removed page)
- 08:26 Oct 8, 2002 Jheijmans deleted "John T. Thompson" (copyright violation, been on votes for deletion for some time)
- 08:25 Oct 8, 2002 Jheijmans deleted "Talk:Kaspar Schlick" (talk page of removed page)
- 08:25 Oct 8, 2002 Jheijmans deleted "Kaspar Schlick" (copyright violation (in German), been on votes for deletion for some time)
- 07:45 Oct 8, 2002 Maveric149 deleted "Manned space mission" (content moved. Getting this out of the way for a correct move)
- 06:53 Oct 8, 2002 Jheijmans deleted "Lost Jerusalem" (redirect, needed for move)
- 06:52 Oct 8, 2002 Jheijmans deleted "Eldridge" (redirect, needed for move)
- 06:52 Oct 8, 2002 Jheijmans deleted "Neo Jerusalem" (redirect, needed for move)
- 06:51 Oct 8, 2002 Jheijmans deleted "Aveh" (redirect, needed for move)
- 06:40 Oct 8, 2002 Maveric149 deleted "Rubber tire" (blank; junk in history)
- 06:40 Oct 8, 2002 WojPob deleted "APHMEC" (a non-article, requested)
- 06:34 Oct 8, 2002 Jheijmans deleted "Teddy Flack" (\"Put your text for the new page here.i want a picture of teddy flack \")
- 06:33 Oct 8, 2002 Jheijmans deleted "Non-zero-sum games" (\"An example of a non-zero sum game would be the classic Bean game\")
- 06:32 Oct 8, 2002 Jheijmans deleted "Description" (\"Description: words used to demonstrate the attributes of\")
- 06:25 Oct 8, 2002 Jheijmans deleted "Meet in the middle" (\"Put your text for the new page here. Haha..\")
- 06:25 Oct 8, 2002 Jheijmans deleted "Miniscule" (\"really small, insignificant, neglible\" (should be min_u_scule, anyway))
- 06:24 Oct 8, 2002 Jheijmans deleted "Joseph-Marie Jacquard" (\"he smelled like a pig donkey buttmunch.\")
- 06:23 Oct 8, 2002 Jheijmans deleted "William Bradford" (\"Put your text for the new page he\")
- 06:23 Oct 8, 2002 Jheijmans deleted "Hokkien" (\"Beautiful Country \")
- 06:23 Oct 8, 2002 Jheijmans deleted "Fad" (empty, prev \"Main Entry: fad Pronunciation: \'fad Function: noun Etymology: origin unknown Date: 1867 (etc.)\")
- 06:22 Oct 8, 2002 Jheijmans deleted "Dahab, Egypt" (empty, prev \"www.daniela-hotels.com\")
- 05:45 Oct 8, 2002 Maveric149 deleted "Argon/Temp" (temp page that is no longer needed)
- 03:18 Oct 8, 2002 Maveric149 deleted "Kristin Otto" (go to http://www.www.com !!!!its a search engine no that doesnt have anything to do with kristin otto but WHO CARE? hahahahahahahahahahahahahaha )
- 02:18 Oct 8, 2002 Brion VIBBER deleted "Hadrian's Wall" (Cut-n-paste from Hadrian\'s wall; no editing done under this capitalization. Content moved back there, need to delete this one to free up the title for renaming.)
- 01:20 Oct 8, 2002 Maveric149 deleted "Jian" (blank; junk in history)
- 01:18 Oct 8, 2002 Maveric149 deleted "Cape Town" (just a redirect; no history; need to get this out of the way for a move)
- 00:10 Oct 8, 2002 Andre Engels deleted "Berger Roy Al" (copyright violation; has been on votes for deletion for a week)
- 00:08 Oct 8, 2002 Andre Engels deleted "Anarcosocial-communism" (non-subject, moved to meta, on Votes for Deletion)
- 00:08 Oct 8, 2002 Andre Engels deleted "Loyda Morales" (No factual information; has been on votes for deletion for 1 week without dissent)
- 00:07 Oct 8, 2002 Andre Engels deleted "Bonneville Apartments" (looks like an advertisement, has been on Votes for Deletion for 1 week without dissent)
- 23:56 Oct 7, 2002 Maveric149 deleted "London College of Fashion" (The London College of Fashion should be listed under The London Institute. )
- 23:44 Oct 7, 2002 Maveric149 deleted "Mustard agent" (Put your text for the new page here.jhnikjikml;koklp[iu8uiureua9g8qwtnqertijirGJIRJGIJIAERFDARijijsejixjijijiwejgjgirjegiijijijseXJJJIJGIJIREGIGR )
- 23:42 Oct 7, 2002 Maveric149 deleted "Pacific loon" (http://www.birdphotography.com/ )
- 23:08 Oct 7, 2002 Maveric149 deleted "Party congress of the CPSU" (junk; hey guess what im copyrited and you aren tonitng )
- 23:03 Oct 7, 2002 Maveric149 deleted "Law of Canada" (junk; Put your text for the new page here. history of canadian criminal law )
- 22:14 Oct 7, 2002 Lee Daniel Crocker deleted "WINE" (Preparing for move...)
- 21:34 Oct 7, 2002 Tarquin deleted "Madame Grey" (just daft text)
- 17:51 Oct 7, 2002 Jheijmans deleted "Luxembourg/Temp" (temporary page)
- 15:04 Oct 7, 2002 PierreAbbat deleted "S’Archittu" (Junk by 151.29.72.97. Just weblink. Deleted for at least the second time.)
- 14:22 Oct 7, 2002 Tarquin deleted "Dungeons & Dragons (temp)" (temp page)
- 14:22 Oct 7, 2002 Tarquin deleted "Dungeons & Dragons" (making room for move)
- 14:10 Oct 7, 2002 Jheijmans deleted "Nagoya" (getting out of the way for move)
- 13:38 Oct 7, 2002 PierreAbbat deleted "S’Archittu" (title contains weird character; content is only web links)
- 13:27 Oct 7, 2002 Jheijmans deleted "Talk:North Brabant/Temp" (talk page of temporary page - contents moved)
- 13:27 Oct 7, 2002 Jheijmans deleted "North Brabant/Temp" (temporary page)
- 13:24 Oct 7, 2002 WojPob deleted "Defence Intelligence Agency" (spelling wrong, I\'m an idiot)
- 11:06 Oct 7, 2002 Tarquin deleted "Mole (espianoge)" (just babble)
- 10:33 Oct 7, 2002 Andre Engels deleted "Image:Pistols.jpg" (I thought I already did this one - copyright image)
- 10:32 Oct 7, 2002 Andre Engels deleted "Image:Sulfanilamide.png" (I thought I already did this one - replaced by sulfanilamide2.png)
- 10:29 Oct 7, 2002 Andre Engels deleted "Image:Pistols.jpg" (copyrighted)
- 10:27 Oct 7, 2002 Andre Engels deleted "Image:Sulfanilamide.png" (has been replaced by sulfanilamide2.png)
- 07:57 Oct 7, 2002 Isis deleted "Beverly K Effinger" (mistakenly created w/out period on title initial)
- 07:54 Oct 7, 2002 Jheijmans deleted "Guido Carli" (empty, prev \"Put your text for the new page here. wwwc f df e ret fg ert et gf et e fg rg fg\")
- 06:59 Oct 7, 2002 Jheijmans deleted "Djibouti/Temp" (temporary page)
- 06:57 Oct 7, 2002 Maveric149 deleted "Zebulun Kurth-Nelson" (orphan, contents moved to meta; Content moved to m:Zebulun Kurth-Nelson. )
- 06:53 Oct 7, 2002 Maveric149 deleted "Clark Prensoil Potter" (just a link to meta: see m:Clark Pernsoil Potter )
- 06:52 Oct 7, 2002 Maveric149 deleted "Spoken game" (just a link to another article; \"improvisation\" )
- 06:32 Oct 7, 2002 Jheijmans deleted "Airglow" (empty, prev \"Put your text for the new page here. i have no fucking clue\")
- 06:32 Oct 7, 2002 Jheijmans deleted "Interjection" (empyt, prev \"BullShit - founded in 1948\")
- 06:31 Oct 7, 2002 Jheijmans deleted "Babington Conspiracy" (\"a\")
- 06:31 Oct 7, 2002 Jheijmans deleted "Executive department" (\"this is the executive branch.\")
- 06:30 Oct 7, 2002 Jheijmans deleted "Second Athenian Empire" (\"www.new-revo.com !! You love it!\")
- 06:30 Oct 7, 2002 Jheijmans deleted "Stirrer" (\"Put your text for the new page here.;pl\")
- 05:53 Oct 7, 2002 WojPob deleted "Chinese grammar" (no content, no history, deleted)
- 04:26 Oct 7, 2002 Maveric149 deleted "Sexual perversion" (hello )
- 01:50 Oct 7, 2002 Andre Engels deleted "Walter Benjamin" (\" Put your text for the new page here. bbuhjbhubhuuuuuuuuuuuuuuuubuhuuuuuuuuuuuuuuuuuuuuuuuuu\")
- 01:48 Oct 7, 2002 Andre Engels deleted "Canandaigua, New York" (\"can you tell me , where i came a hold of a copy 1830 census for the township of candaigua or the the address of your library fir this townshio dan gallez ddg65@aol.com\")
- 01:45 Oct 7, 2002 Andre Engels deleted "One-party system" (\"Hey whatssup\")
- 01:34 Oct 7, 2002 Stephen Gilbert deleted "Logos and slogans" (my mistake)
- 23:43 Oct 6, 2002 Maveric149 deleted "Rod Carew" (nonarticle; \"Rod Carew was good at playing games. He also was a huge asshole. \")
- 23:40 Oct 6, 2002 Maveric149 deleted "Central heating" (Newbie experiment; \"HI my name is joe \" Hello Joe! Visit the help button on the top of your page to see what the project is about)
- 23:36 Oct 6, 2002 Maveric149 deleted "Internet service provider" (need to get this out of the way for a move)
- 21:50 Oct 6, 2002 Tarquin deleted "National Trust (England, Wales and Northern Ireland) properties" (new page; content moved elsewhere; deletion requested by Nevilley)
- 21:45 Oct 6, 2002 Tarquin deleted "Parse tree" (no intelligible content)
- 19:56 Oct 6, 2002 Jheijmans deleted "Ellobiopsids" (\"kevin michael allesee is the coolest\")
- 19:56 Oct 6, 2002 Jheijmans deleted "Spoken game" (improvisation)
- 19:55 Oct 6, 2002 Jheijmans deleted "Olga Pyleva" (\"Put your text for the new page here.Olga\")
- 19:55 Oct 6, 2002 Jheijmans deleted "New Ipswich, New Hampshire" (\"Rickard F\")
- 19:55 Oct 6, 2002 Jheijmans deleted "A00 Sokolsky Opening 1.e4 e5" (delete requested by initiaor of page)
- 11:08 Oct 6, 2002 Maveric149 deleted "Krypton/Temp" (temp page that is no longer needed)
- 10:32 Oct 6, 2002 WojPob deleted "Tezpur, Assam" (no content, no history, deleted)
- 10:30 Oct 6, 2002 WojPob deleted "Stephen King/Dolans Cadillac" (no content, no history, deleted)
- 07:36 Oct 6, 2002 Koyaanis Qatsi deleted "Not Black supremacy" (\"Put your text for the new page here. uhm...yea...you suck \")
- 07:17 Oct 6, 2002 Jheijmans deleted "Mythology of demons" (empty, \"yo here is what i say fuck off le let me stay\")
- 07:16 Oct 6, 2002 Jheijmans deleted "Babington Conspiracy" (empty, \"you shouldn\'t allow people to edit these pages\" )
- 07:15 Oct 6, 2002 Jheijmans deleted "Diplomonads" (\"lick my balls\" )
- 07:15 Oct 6, 2002 Jheijmans deleted "Moose Jaw" (\"31000 POPULATION\" )
- 07:15 Oct 6, 2002 Jheijmans deleted "1 E21 m" (\"girth of my wang\" (by user Hfastedge?))
- 07:14 Oct 6, 2002 Jheijmans deleted "Florianus" (eh? )
- 21:37 Oct 5, 2002 Brion VIBBER deleted "Junk page that is being deleted to confirm bug is fixed" (Deletion log time zone bug)
- 23:15 Oct 5, 2002 WojPob deleted "Mass Production" (no content, no history, removed)
- 09:51 Oct 5, 2002 Maveric149 deleted "Helsinki" (getting this out of the way for a move; just a redirect)
- 14:13 Oct 5, 2002 The Epopt deleted "C-46 Commando" (copyright violation)
- 14:13 Oct 5, 2002 The Epopt deleted "C-47 Skytrain" (copyright violation)
- 14:29 Oct 5, 2002 Scipius deleted "Das Kapital" (Full text: moon boom)
- 06:19 Oct 5, 2002 Maveric149 deleted "Human" (just a redirect; no history; need to get this out of the way for a move)
- 06:17 Oct 5, 2002 Maveric149 deleted "Humans" (just a redirect, has never been anything else; need to get this out of the way for a complicated move)
- 13:10 Oct 5, 2002 Scipius deleted "Testingwhetherthereisalimittothelengthsofpagenamesddlskdlaskdnvlknancsklnasnfdoaiwnrpiwnrpqnrpqwnrpiqnneifniqnfiqwnipqwnfiqwnfiqwnfpiwqnfpinfipqnfipqwnfipnqwfpniwnfqpmmqcpomowmcmcopqwmpowcmopqwmcoqwpmcowpqmcopqmwcopwmcopmqcwopmcopqmwocpmwocmopcwqmopwqmcop" (Lir was testing the pagename length)
- 19:26 Oct 4, 2002 Maveric149 deleted "Wikipedia:Tom Tommorrow" (orphan, made my mistake)
- 21:44 Oct 4, 2002 Tarquin deleted "Coppicing/pollarding" (new page; already moved to better title)
- 22:58 Oct 4, 2002 Ed Poor deleted "SPIHT" (graffiti)
- 20:35 Oct 4, 2002 Jheijmans deleted "Horace de Saussure" (\"Put your text for the new page\")
- 20:35 Oct 4, 2002 Jheijmans deleted "Cisternae" (\"ur a dork and a half.\")
- 20:35 Oct 4, 2002 Jheijmans deleted "Israeli Security Zone" (empty, prev \"hola it\'s me\'s again ha ha ha ha.\")
- 20:35 Oct 4, 2002 Jheijmans deleted "United Nations Partition Plan" (empty, prev \"hola chicos, and chicas. me just a normal school kid at school. i don\'t know what i\'m doing so audios\")
- 17:39 Oct 4, 2002 Koyaanis Qatsi deleted ".phtml" (total content == \"Yo wazzup! Nothin\' here. Surf somewhere else. LOL ROTFL\", no pages linking to it, possiblly created to attempt some kind of exploit)
- 18:43 Oct 4, 2002 Ed Poor deleted "State sponsors of terrorism" (created this redirect page by mistake)
- 17:43 Oct 4, 2002 Jheijmans deleted "Ghent" (getting out of the way for move)
- 12:55 Oct 4, 2002 Andre Engels deleted "Pearson Hashing" (newbie test)
- 12:37 Oct 4, 2002 Andre Engels deleted "Duck duck goose" (\"The only game yet created where the winner, indeed, becomes the duck\")
- 12:05 Oct 4, 2002 Jheijmans deleted "Exchange rate" (\"Put your text for the new page here.ppp\")
- 11:10 Oct 4, 2002 Andre Engels deleted "Red Sonja" (Wikipedia is not a link depository (\"Read the review <a href=\"http://www.thespinningimage.co.uk/cultfilms/displaycultfilm.asp?reviewid=265\">here.</a>\"))
- 11:07 Oct 4, 2002 Andre Engels deleted "Johan Helsingius" (\"A big guy with tiny balls\")
- 11:01 Oct 4, 2002 Andre Engels deleted "I didn't change anything!" (phrase not characteristic enough to warrant an encyclopedia entry; been put on \'Votes for deletion\' by Jeronimo qabout 2 weeks ago)
- 08:54 Oct 4, 2002 Jheijmans deleted "Emotional punditry" (redirect, needed for move)
- 08:54 Oct 4, 2002 Jheijmans deleted "Environmental wacko" (redirect, needed for move)
- 08:51 Oct 4, 2002 Jheijmans deleted "StarEdit" (redirect, needed for move)
- 08:49 Oct 4, 2002 Jheijmans deleted "Thames/pollution" (\"Just an empty page at the moment.\")
- 08:45 Oct 4, 2002 Jheijmans deleted "Ekumen" (redirect, needed for move)
- 08:44 Oct 4, 2002 Jheijmans deleted "The Dispossessed" (redirect, needed for move)
- 08:34 Oct 4, 2002 Jheijmans deleted "Vitamin E familial isolated, deficiency of" (copyright violation, been on votes for deletion for some time)
- 08:34 Oct 4, 2002 Jheijmans deleted "Clara Thrupp" (\"She was born on the 1st July 1992. She has been in some school plays. One of her most famous roles was as a vogue dancer and in the choir. \" listed on votes for some time)
- 08:33 Oct 4, 2002 Jheijmans deleted "Eric Hoffman" (personal page about a family member of a user (Grouse). \"contents\" already on that page.)
- 08:32 Oct 4, 2002 Jheijmans deleted "Talk:Belief" (talk page of removed page)
- 08:32 Oct 4, 2002 Jheijmans deleted "Belief" (no contents, been on votes for deletion for some time)
- 08:31 Oct 4, 2002 Jheijmans deleted "Carol" (copyright violation, been on votes for deletion for some time)
- 08:29 Oct 4, 2002 Jheijmans deleted "Dinant" (\"Put your text for the new page here. Dinantee\")
- 08:29 Oct 4, 2002 Jheijmans deleted "Stevertigo" (\"i can be emailed at stevertigo@nupedia.com\")
- 08:29 Oct 4, 2002 Jheijmans deleted "Secret key" (\"testing one two three\")
- 08:29 Oct 4, 2002 Jheijmans deleted "Dorchester, England" (\"An English place\")
- 08:29 Oct 4, 2002 Jheijmans deleted "G3" (\"Banas\")
- 08:28 Oct 4, 2002 Jheijmans deleted "Philosophical Investigations/family resemblance" (empty, prev \"When the bird meets the bee, you lookalike both the bird and bee. Logically it can be expressed a=b=ab. In this way, you lookalike the rest of your clan.\")
- 08:28 Oct 4, 2002 Jheijmans deleted "Aswan High Dam" (empty, prev \"khbkjgabkjglkjdfjgljdhgl;ihuitkjkgjbdkjfvbbvkjdbvbjkbjkbvkdbvkvbskjvbv kjbbiufdbv\")
- 08:28 Oct 4, 2002 Jheijmans deleted "U.s. presidental election, 1948" (empty, prev \"The election of 1948 was considered by far the most fucked up of them all (cont.)\")
- 08:27 Oct 4, 2002 Jheijmans deleted "Sunset" (empty, prev \"LASER (repeated a lot of times)\" )
- 08:27 Oct 4, 2002 Jheijmans deleted "TWA 847 hijacking" (empty, no previous contents)
- 06:22 Oct 4, 2002 Brion VIBBER deleted "Green economics" (History is a series of redirects and a cut-n-paste from Green economist. Deleting to make room for rename of that page in this page.)
- 08:18 Oct 4, 2002 WojPob deleted "Howdoudeleteapage" (no significant history, deleted)
- 23:58 Oct 3, 2002 Brion VIBBER deleted "Green Economism" (Cut-n-paste move from Green economist; no actual editing history. Text has been moved back there, need to remove to make room for potential rename)
- 19:15 Oct 3, 2002 Jheijmans deleted "Existentialism/Old" (old text, copied to talk)
- 18:27 Oct 3, 2002 Jheijmans deleted "Toe" (\"Toe: a finger like object that grows off the foot.\")
- 18:26 Oct 3, 2002 Jheijmans deleted "Electrostatic field" (\"Put your text for the new page here. ciao\")
- 18:25 Oct 3, 2002 Jheijmans deleted "Henri Désiré Landru" (\"PLEASE FILL THIS IN!\")
- 18:24 Oct 3, 2002 Jheijmans deleted "Marcel Petiot" (\"hello i am alex\")
- 10:27 Oct 3, 2002 Brion VIBBER deleted "Santa Cruz Operation" (Cut-n-paste from SCO, no history; needs to be deleted to make room for a proper rename)
- 12:16 Oct 3, 2002 Jheijmans deleted "Adzuki bean" (\"Adzuki bean\")
- 11:48 Oct 3, 2002 Jheijmans deleted "Obfuscating software" (\"asdfasdf\")
- 10:28 Oct 3, 2002 Tarquin deleted "Hazaed (game)" (name with typo)
- 11:19 Oct 3, 2002 Jheijmans deleted "Brazil's anthem, entitled Hino Nacional Brasileiro" (poorly title and \"HIOugpgu\" as content)
- 09:10 Oct 3, 2002 Jheijmans deleted "San Marino/Temp" (temporary page)
- 09:01 Oct 3, 2002 Jheijmans deleted "Seth Howard" (already on meta)
- 09:01 Oct 3, 2002 Jheijmans deleted "Weak entity" (\"hello\")
- 09:00 Oct 3, 2002 Jheijmans deleted "Philip III of Spain" (\"Philip III of Spain. hi!!!!\")
- 08:58 Oct 3, 2002 Jheijmans deleted "Charles Spurgeon" (copyright violation, been on votes for deletion for some time)
- 08:57 Oct 3, 2002 Jheijmans deleted "Hans Eijsackers" (copyright violation, been on votes for deletion for some time)
- 08:57 Oct 3, 2002 Jheijmans deleted "Morals or Ethics" (already on meta)
- 08:56 Oct 3, 2002 Jheijmans deleted "Curved Air" (copyright violation, been on votes for deletion for some time)
- 08:56 Oct 3, 2002 Jheijmans deleted "Bad Religion" (copyright violation, been on votes for deletion for some time)
- 08:55 Oct 3, 2002 Jheijmans deleted "Pcl" (\"Dit is een test van Jan-WIllem\")
- 08:55 Oct 3, 2002 Jheijmans deleted "Meersburg" (\"http://www.mainau.de/\")
- 08:54 Oct 3, 2002 Jheijmans deleted "Mainau Island" (\"http://www.mainau.de/ \")
- 08:54 Oct 3, 2002 Jheijmans deleted "Hugh Richardson" (\"hee hee hee hee\")
- 08:53 Oct 3, 2002 Jheijmans deleted "Andraé Crouch" (empty, prev \"I would like to edit this, if only I knew what to do...lol\")
- 08:53 Oct 3, 2002 Jheijmans deleted "Battle of Lexington and Concord" (empyt, prev \"what did the blind man say as he walked past the tuna factory?\")
- 08:52 Oct 3, 2002 Jheijmans deleted "Flight AF 8969 Alger-Paris hijacked" (empyt, prev \"your mom hijacked a plane but she was too fat to fit into a seat and it crashed anyway... \")
- 08:50 Oct 3, 2002 Jheijmans deleted "University of Kiel" (empyt, prev \"A university of Phsycokenises in Northern Germany\")
- 08:50 Oct 3, 2002 Jheijmans deleted "Yang di-Pertuan Agong" (empyt, prev \"king\")
- 23:48 Oct 2, 2002 Maveric149 deleted "Predicate calculus" (junk \" Put your text for the new page here.ggbvbvbvbbvbvbvbvbvbvbv \")
- 23:46 Oct 2, 2002 Maveric149 deleted "Radon/Temp" (temp page that is no longer needed)
- 19:47 Oct 2, 2002 PierreAbbat deleted "Battle of Lutzen" (useless non-article just says \"Lutzen\")
- 19:45 Oct 2, 2002 PierreAbbat deleted "Talk:Electronic filter" (garbage left long ago by a passing IP: \" Its wikkid, www.horlix.com\")
- 19:15 Oct 2, 2002 PierreAbbat deleted "Blue Gene" (garbage by 65.58.149.45; only content: \"FUCK FUCK FUCK\")
- 01:43 Oct 3, 2002 Andre Engels deleted "Roman emperor" (created this as a redirect to a page I thought existed but didn\'t)
- 22:00 Oct 2, 2002 Brion VIBBER deleted "Peasants' Revolt" (Junk comment, was recommended for deletion, need to take it out to make room for renaming better already existing article)
- 23:29 Oct 2, 2002 Andre Engels deleted "Port Royal" ( this is pathetic you dont even have info!! hello???)
- 22:04 Oct 2, 2002 Tarquin deleted "Antiwikipedic"
- 21:47 Oct 2, 2002 Tarquin deleted "Antiwikipedic" (no, it\'s already been agreed that this page belongs on the Meta site. If I\'m mistaken, please let me know on my talk page. And besides, you shouldn\'t create pages with no content)
- 21:40 Oct 2, 2002 Tarquin deleted "Antiwikipedic" (hello, goodbye)
- 22:43 Oct 2, 2002 -- April deleted "Antiwikipedic" (Exists on meta.)
- 22:27 Oct 2, 2002 -- April deleted "Antiwikipedic" (Article is on meta /and/ Wikipedia namespace. Doesn\'t belong here. )
- 20:28 Oct 2, 2002 -- April deleted "Antiwikipedic" (Not a word. Page exists on meta. IP blocked.)
- 20:24 Oct 2, 2002 -- April deleted "Antiwikipedic" (Not a word. Page exists on meta.)
- 20:09 Oct 2, 2002 -- April deleted "Wikipedic" (Page exists on meta, where it belongs. Use m:Wikipedic to reference.)
- 20:08 Oct 2, 2002 -- April deleted "Wikipedia: Antiwikipedic" (Page exists on meta, where it belongs.)
- 20:07 Oct 2, 2002 -- April deleted "Antiwikipedic" (Page exists on meta, where it belongs.)
- 19:52 Oct 2, 2002 -- April deleted "Antiwikipedic" (This is not a forum for creating terms. Place on meta or in wikipedia: namespace.)
- 15:54 Oct 2, 2002 Koyaanis Qatsi deleted "Antiwikipedic" (this page is not encyclopedic material. wikipedia is not the place to coin a term or post original research)
- 15:43 Oct 2, 2002 Koyaanis Qatsi deleted "AntiWikipedic" (deleted. not in error.)
- 00:42 Oct 3, 2002 Stephen Gilbert deleted "Stephen Gilbert" (old, orphaned user page redirect)
- 00:32 Oct 3, 2002 Stephen Gilbert deleted "STG" (my old sig redirect, now an orphan)
- 17:01 Oct 2, 2002 Andre Engels deleted "Laurasia" (Full text: \"hello?\")
- 16:52 Oct 2, 2002 Andre Engels deleted "CTSS" (I was just wondering what CTSS is and thought if I clicked that link I would find my answer. )
- 16:17 Oct 2, 2002 Jheijmans deleted "Maurice" (\"huh?\")
- 14:01 Oct 2, 2002 Andre Engels deleted "Riptor's articles" (recently created User page; moved to User:Riptor/Riptor\'s articles)
- 09:20 Oct 2, 2002 Jheijmans deleted "Transaction processing" (\"JKJKJKJ\")
- 09:08 Oct 2, 2002 Jheijmans deleted "In Vitro Fertilisation/Todo" (obsolete subpage, contents in talk)
- 08:50 Oct 2, 2002 Andre Engels deleted "Global warming/Todo" (Old /Todo page; content has been copied to Global warming:Talk)
- 08:45 Oct 2, 2002 Jheijmans deleted "Fuller Theological Seminary" (\"http://www.fuller.edu\" )
- 08:23 Oct 2, 2002 Jheijmans deleted "Pseudorandom" (\"Put your text for the new page here. New page test\")
- 08:22 Oct 2, 2002 Jheijmans deleted "Vaux-le-Vicomte" (\"pussy?\")
- 08:21 Oct 2, 2002 Jheijmans deleted "Ann Theresa de Keersmaker" (empty, prev \"hoi\")
- 23:21 Oct 1, 2002 Maveric149 deleted "Barney Rubble" (off topic and slang usage to boot \" In England the term Barney is used against someone who is not a babe, but rather unattractive. \")
- 23:00 Oct 1, 2002 Maveric149 deleted "Ned Ludd" (junk \" douchebag \")
- 23:00 Oct 1, 2002 Maveric149 deleted "Self-starvation" (junk \" tyujjjj \")
- 22:57 Oct 1, 2002 Maveric149 deleted "Middle High German" (newbie experimenet \" hello \" Hi there)
- 22:54 Oct 1, 2002 Maveric149 deleted "Aeolic" (nebie experiment; \" hello there how are you? \" I\'m fine )
- 22:53 Oct 1, 2002 Maveric149 deleted "Oliver Ellsworth" (junk \" Put your text for the new page here. Wassup foos \")
- 22:52 Oct 1, 2002 Maveric149 deleted "HMAS Darwin" (removed website ad)
- 22:52 Oct 1, 2002 Maveric149 deleted "Chemical burn" (rubbish; \" Can cause up to 4th degree burns \" so can many other things)
- 22:51 Oct 1, 2002 Maveric149 deleted "Fluoride" (junk \" It\'s not a yummy substance...uck!! \")
- 18:57 Oct 1, 2002 Andre Engels deleted "Stem cell/Todo" (/Todo page from November last year. The actual text on the page has been moved to Talk:Stem cell)
- 01:06 Oct 2, 2002 Stephen Gilbert deleted "Wikipedia talk:What Google Likes" (deleting my dumb mistake)
- 09:57 Oct 1, 2002 Tarquin deleted "Guiness Book of World Records" (new page created with just offensive comment)
- 10:39 Oct 1, 2002 Jheijmans deleted "Peat bog" (empty, prev \"Hi, a peat bog is i don\'t know what\")
- 09:50 Oct 1, 2002 Jheijmans deleted "Ashtanga Yoga" (\"Brutal spankings.\")