Wikipedia:Historical archive/Logs/Deletion log/October 2002: Difference between revisions

Browse history interactively

← Previous edit Next edit →

Content deleted Content added

VisualWikitext

Inline

Revision as of 03:48, 24 August 2007

Wikipedia:Deletion log Archive for October 2002 (936 deletions)

22:08 Oct 31, 2002 Maveric149 deleted "Computer keyboard"
20:47 Oct 31, 2002 Tarquin deleted "Solar tower"
15:55 Oct 31, 2002 Jheijmans deleted "Modern Pentathlon at the 1936 Summer Olympics"
09:43 Oct 31, 2002 Magnus Manske deleted "Saint-Cyr"
08:46 Oct 31, 2002 Magnus Manske deleted "Data storage"
08:11 Oct 31, 2002 Jheijmans deleted "Liar (short story)"
08:11 Oct 31, 2002 Jheijmans deleted "Sumerian Early Dynastic period"
08:10 Oct 31, 2002 Jheijmans deleted "Analog first generation"
08:10 Oct 31, 2002 Jheijmans deleted "Automaton"
08:10 Oct 31, 2002 Jheijmans deleted "State diagram"
08:10 Oct 31, 2002 Jheijmans deleted "Talk:2209"
08:10 Oct 31, 2002 Jheijmans deleted "2209"
08:09 Oct 31, 2002 Jheijmans deleted "Turing reduction"
08:09 Oct 31, 2002 Jheijmans deleted "Kitakyushu"
08:08 Oct 31, 2002 Jheijmans deleted "Fraser River"
08:08 Oct 31, 2002 Jheijmans deleted "La Cliqua"
08:07 Oct 31, 2002 Jheijmans deleted "Ad hoc protocol list"
07:37 Oct 31, 2002 JeLuF deleted "Sir Andrew Ramsay"
07:37 Oct 31, 2002 JeLuF deleted "Synonymy"
06:48 Oct 31, 2002 Sjc deleted "Peter Tosh"
05:32 Oct 31, 2002 Brion VIBBER deleted "Christian Dior"
05:22 Oct 31, 2002 Maveric149 deleted "Rhenium/Temp"
03:36 Oct 31, 2002 PierreAbbat deleted "Richard Leakey"
23:58 Oct 30, 2002 PierreAbbat deleted "Charles's law"
22:55 Oct 30, 2002 The Epopt deleted "Agosta 90B class submarine"
20:36 Oct 30, 2002 JeLuF deleted "Olde Cheshire Cheese (London pub)"
20:35 Oct 30, 2002 JeLuF deleted "Top-down"
20:34 Oct 30, 2002 JeLuF deleted "Nearest neighbor algorithm"
20:33 Oct 30, 2002 JeLuF deleted "Dog whistle"
20:32 Oct 30, 2002 JeLuF deleted "Sforzando"
18:57 Oct 30, 2002 Tarquin deleted "BLT sandwitch"
18:56 Oct 30, 2002 Tarquin deleted "BLT sandwich"
18:54 Oct 30, 2002 Tarquin deleted "Club sandwich"
15:51 Oct 30, 2002 Tarquin deleted "N'Djamena"
15:50 Oct 30, 2002 Ed Poor deleted "Renaming page, as suggested"
15:46 Oct 30, 2002 Tarquin deleted "WikiWiki)"
15:37 Oct 30, 2002 Magnus Manske deleted "WikiWiki)"
12:52 Oct 30, 2002 Brion VIBBER deleted "CMOS Memory"
12:14 Oct 30, 2002 Tarquin deleted "Nipple piercing"
10:50 Oct 30, 2002 Jheijmans deleted "De Witt Clinton"
10:50 Oct 30, 2002 Jheijmans deleted "Preda Mihailescu"
10:50 Oct 30, 2002 Jheijmans deleted "When it Happens"
10:49 Oct 30, 2002 Jheijmans deleted "Mossel Bay"
04:32 Oct 30, 2002 Brion VIBBER deleted "Zu Chen"
04:32 Oct 30, 2002 Brion VIBBER deleted "Jun Xie"
01:28 Oct 30, 2002 PierreAbbat deleted "Henri D�sir� Landru"
23:10 Oct 29, 2002 Brion VIBBER deleted "Mercury-in-glass thermometer"
23:01 Oct 29, 2002 PierreAbbat deleted "Thylakoid"
22:54 Oct 29, 2002 PierreAbbat deleted "Image:Vaag.JPG"
21:26 Oct 29, 2002 Jheijmans deleted "Edit"
21:26 Oct 29, 2002 Jheijmans deleted "Tramping"
20:20 Oct 29, 2002 JeLuF deleted "Lloyd Bentsen"
19:21 Oct 29, 2002 Tarquin deleted "Harry Potter and the Order of the Phoenix"
17:32 Oct 29, 2002 Ed Poor deleted "Moscow theatre siege"
13:59 Oct 29, 2002 Brion VIBBER deleted "Hitler: The Last Ten Days"
13:52 Oct 29, 2002 Brion VIBBER deleted "Battle of Otford"
13:31 Oct 29, 2002 Brion VIBBER deleted "Talk:Hafez al-Assad"
13:30 Oct 29, 2002 Brion VIBBER deleted "Image talk:Hitler.jpg"
13:27 Oct 29, 2002 Brion VIBBER deleted "Sukarno"
13:26 Oct 29, 2002 Brion VIBBER deleted "Suharto"
11:26 Oct 29, 2002 Karen Johnson deleted "X/Open"
10:00 Oct 29, 2002 Karen Johnson deleted "Peasant rebellion"
09:53 Oct 29, 2002 Karen Johnson deleted "University of Birmingham"
09:51 Oct 29, 2002 Karen Johnson deleted "Dictionary of the Norwegian Dialects"
09:14 Oct 29, 2002 Brion VIBBER deleted "St. Paul's Cathedral"
07:52 Oct 29, 2002 Jheijmans deleted "Bob Kane"
07:13 Oct 29, 2002 JeLuF deleted "Pi-calculus"
07:13 Oct 29, 2002 JeLuF deleted "Dwarf elliptical galaxy"
05:23 Oct 29, 2002 AxelBoldt deleted "Post system"
04:21 Oct 29, 2002 Koyaanis Qatsi deleted "Image:Aalayout.jpg"
03:27 Oct 29, 2002 PierreAbbat deleted "0001 B.C."
03:24 Oct 29, 2002 PierreAbbat deleted "Talk:Hydroelectricity"
03:23 Oct 29, 2002 PierreAbbat deleted "Archaism"
03:09 Oct 29, 2002 Karen Johnson deleted "Image:Marigoldthumbnail.pg.jpg"
03:07 Oct 29, 2002 Karen Johnson deleted "Mechanical energy"
03:06 Oct 29, 2002 Karen Johnson deleted "Breach of contract"
03:06 Oct 29, 2002 Karen Johnson deleted "Isolating language"
03:05 Oct 29, 2002 Karen Johnson deleted "Gush Shalom"
03:05 Oct 29, 2002 Karen Johnson deleted "Push-down automaton"
03:04 Oct 29, 2002 Karen Johnson deleted "Morrill act"
01:03 Oct 29, 2002 Tarquin deleted "OMW"
19:43 Oct 28, 2002 JeLuF deleted "Free Software movement"
18:23 Oct 28, 2002 Jheijmans deleted "Fabio"
18:22 Oct 28, 2002 Jheijmans deleted "Application server"
15:56 Oct 28, 2002 Ed Poor deleted "Unification Church and anti-Semitism"
15:49 Oct 28, 2002 Tarquin deleted "Cut in"
14:12 Oct 28, 2002 Jheijmans deleted "Rembrandt"
12:51 Oct 28, 2002 Magnus Manske deleted "Asian crisis"
08:10 Oct 28, 2002 Maveric149 deleted "Nonviolence"
07:53 Oct 28, 2002 Jheijmans deleted "Andorra la Vella"
06:51 Oct 28, 2002 Karen Johnson deleted "Mitochondrial membrane"
06:40 Oct 28, 2002 Karen Johnson deleted "Michigan Rummy"
06:10 Oct 28, 2002 Karen Johnson deleted "The war against Reform and Conservative Judaism"
06:03 Oct 28, 2002 Koyaanis Qatsi deleted "David Matthews"
05:50 Oct 28, 2002 Karen Johnson deleted "Demagoguery"
05:47 Oct 28, 2002 Karen Johnson deleted "Motor coil resistance"
05:40 Oct 28, 2002 Karen Johnson deleted "Hollywood Babylon"
05:40 Oct 28, 2002 Karen Johnson deleted "Tax evasion"
05:39 Oct 28, 2002 PierreAbbat deleted "Progenote"
05:39 Oct 28, 2002 Karen Johnson deleted "Progenote"
05:38 Oct 28, 2002 Karen Johnson deleted "Tollund"
05:37 Oct 28, 2002 Karen Johnson deleted "Meet in the middle"
05:26 Oct 28, 2002 PierreAbbat deleted "Lock and key"
02:53 Oct 28, 2002 Maveric149 deleted "Spindle"
02:24 Oct 28, 2002 Karen Johnson deleted "Talk:Mystery"
01:13 Oct 28, 2002 Isis deleted "Image:Tartan.PNG"
00:58 Oct 28, 2002 Maveric149 deleted "Image:Tour group entering South Portal of Yucca Mountain.jpg"
00:58 Oct 28, 2002 Maveric149 deleted "Image:Tour group entering South Portal of Yucca Mountain.jpg"
22:58 Oct 27, 2002 PierreAbbat deleted "Colouring algorithm"
22:04 Oct 27, 2002 Jheijmans deleted "Frederick II of Naples"
21:10 Oct 27, 2002 Jheijmans deleted "Shopping mall"
20:20 Oct 27, 2002 Scipius deleted "Estonia/Temp"
19:45 Oct 27, 2002 JeLuF deleted "Black widow spider"
19:37 Oct 27, 2002 Maveric149 deleted "Fort Garry"
17:17 Oct 27, 2002 JeLuF deleted "Fluorescent light"
17:15 Oct 27, 2002 JeLuF deleted "Rollie Fingers"
17:13 Oct 27, 2002 JeLuF deleted "Dogrib"
17:06 Oct 27, 2002 JeLuF deleted "Page Widening"
14:28 Oct 27, 2002 Magnus Manske deleted "Image:Soldierwithwings thumb.htm"
12:31 Oct 27, 2002 Jheijmans deleted "User:Jheijmans/Zandbak"
12:03 Oct 27, 2002 Jheijmans deleted "Quantum dot computer"
12:02 Oct 27, 2002 Jheijmans deleted "Joel David Bondurant"
12:01 Oct 27, 2002 Jheijmans deleted "Kassubian"
08:34 Oct 27, 2002 JeLuF deleted "Goddess of Democracy"
07:41 Oct 27, 2002 Maveric149 deleted "John Wilkins"
03:13 Oct 27, 2002 Brion VIBBER deleted "Basidium"
03:09 Oct 27, 2002 Brion VIBBER deleted "Espionage Act"
02:34 Oct 27, 2002 PierreAbbat deleted "Eurpoean"
01:10 Oct 27, 2002 PierreAbbat deleted "Talk:Francesco Andreini"
22:04 Oct 26, 2002 Maveric149 deleted "User:194.117.133.196"
21:58 Oct 26, 2002 Maveric149 deleted "Hilary rosen"
21:57 Oct 26, 2002 Maveric149 deleted "Excrement"
21:57 Oct 26, 2002 Maveric149 deleted "Contructophobia"
21:56 Oct 26, 2002 Maveric149 deleted "0o0o0o0o0o0o0o0o0o0"
21:55 Oct 26, 2002 Maveric149 deleted "WikiWikiWikiWiki"
21:05 Oct 26, 2002 Maveric149 deleted "Greek Orthodox"
20:01 Oct 26, 2002 Danny deleted "Hormizd II of Persai"
18:56 Oct 26, 2002 Scipius deleted "Jules Bonnot"
15:17 Oct 26, 2002 Jheijmans deleted "Zacharias Janssen"
15:16 Oct 26, 2002 Jheijmans deleted "Krankenhaus"
15:15 Oct 26, 2002 Jheijmans deleted "Mayan hieroglyph"
15:15 Oct 26, 2002 Jheijmans deleted "MIPS architecture/Instructions"
15:14 Oct 26, 2002 Jheijmans deleted "PC-DOS"
14:15 Oct 26, 2002 Jheijmans deleted "China/Temp"
12:52 Oct 26, 2002 Jheijmans deleted "Ancient Roman eschatology"
12:52 Oct 26, 2002 Jheijmans deleted "Albert Luthuli"
12:09 Oct 26, 2002 JeLuF deleted "Matabele"
07:18 Oct 26, 2002 JeLuF deleted "Mars bar"
07:17 Oct 26, 2002 JeLuF deleted "IEEE 802.10"
05:18 Oct 26, 2002 The Cunctator deleted "Image:Paul Wellstone.jpg"
22:41 Oct 25, 2002 Ed Poor deleted "Talk:Ded reckoning"
22:09 Oct 25, 2002 JeLuF deleted "Mo Vaughn"
22:08 Oct 25, 2002 JeLuF deleted "Wally Joyner"
21:03 Oct 25, 2002 JeLuF deleted "Mark Shuttleworth"
21:00 Oct 25, 2002 JeLuF deleted "Portal circulation"
20:51 Oct 25, 2002 JeLuF deleted "Random number generator"
20:13 Oct 25, 2002 Tarquin deleted "Babylonian numerals"
19:16 Oct 25, 2002 Sjc deleted "User:193.251.9.132 is back for more"
19:15 Oct 25, 2002 Koyaanis Qatsi deleted "Image:Hello.jpg"
19:15 Oct 25, 2002 Sjc deleted "Image:Hello.jpg"
19:12 Oct 25, 2002 Koyaanis Qatsi deleted "Image:Widening"
19:01 Oct 25, 2002 Koyaanis Qatsi deleted "Wikipedia:Ram-man"
18:49 Oct 25, 2002 Sjc deleted [redacted]
18:43 Oct 25, 2002 Koyaanis Qatsi deleted [redacted]
18:29 Oct 25, 2002 Jheijmans deleted "Path integral"
18:29 Oct 25, 2002 Jheijmans deleted "Statistical distribution"
18:28 Oct 25, 2002 Jheijmans deleted "Precious metal"
18:26 Oct 25, 2002 Jheijmans deleted "Joel David Bondurant"
18:26 Oct 25, 2002 Jheijmans deleted "Buffalo Bill"
18:26 Oct 25, 2002 Jheijmans deleted "Phylogenetic tree"
18:26 Oct 25, 2002 Jheijmans deleted "Residue"
18:25 Oct 25, 2002 Jheijmans deleted "Distance-vector routing protocol"
18:25 Oct 25, 2002 Jheijmans deleted "Concordance"
18:22 Oct 25, 2002 Jheijmans deleted "Cross-country running"
18:21 Oct 25, 2002 Jheijmans deleted "Royal Tombs of Ur"
18:21 Oct 25, 2002 Jheijmans deleted "Pictograph"
18:21 Oct 25, 2002 Jheijmans deleted "Allotheria"
18:21 Oct 25, 2002 Jheijmans deleted "Retrograde extrapolation"
18:21 Oct 25, 2002 Jheijmans deleted "Retrograde extrapolation"
18:20 Oct 25, 2002 Jheijmans deleted "Cape Fear"
18:20 Oct 25, 2002 Jheijmans deleted "Pierre Sauvignon de Brazza"
15:50 Oct 25, 2002 Andre Engels deleted "Sulfide"
15:48 Oct 25, 2002 Andre Engels deleted "Cupper sulfide"
09:35 Oct 25, 2002 Magnus Manske deleted "Markov algorithm"
08:47 Oct 25, 2002 Karen Johnson deleted "Mahmud I"
00:27 Oct 25, 2002 Koyaanis Qatsi deleted "Locro"
00:26 Oct 25, 2002 Koyaanis Qatsi deleted "Marching music"
21:18 Oct 24, 2002 JeLuF deleted "On-Line Medical Dictionary"
21:17 Oct 24, 2002 JeLuF deleted "Bureau of Standards"
21:16 Oct 24, 2002 JeLuF deleted "Frozen Four"
21:15 Oct 24, 2002 JeLuF deleted "The Fall of the House of Usher"
21:13 Oct 24, 2002 JeLuF deleted "Minbar"
21:13 Oct 24, 2002 JeLuF deleted "John Purroy Mitchel"
21:12 Oct 24, 2002 JeLuF deleted "FFS"
18:50 Oct 24, 2002 The Cunctator deleted "Talk:Beltway Sniper"
18:49 Oct 24, 2002 The Cunctator deleted "Beltway Sniper"
17:26 Oct 24, 2002 Ed Poor deleted "Keep on trollin trollin trollin"
17:23 Oct 24, 2002 Koyaanis Qatsi deleted "Image:Hello.jpg"
14:08 Oct 24, 2002 Jheijmans deleted "Sunne"
13:42 Oct 24, 2002 Jheijmans deleted "-lvsbyn"
13:14 Oct 24, 2002 Jheijmans deleted "Berg"
08:01 Oct 24, 2002 Koyaanis Qatsi deleted "THX 1138:4EB"
07:42 Oct 24, 2002 Jheijmans deleted "Rustler's knot"
07:41 Oct 24, 2002 Jheijmans deleted "Duotrigintillion"
07:41 Oct 24, 2002 Jheijmans deleted "Mudhoney"
07:40 Oct 24, 2002 Jheijmans deleted "Geheimfernschreiber"
07:40 Oct 24, 2002 Jheijmans deleted "Projection"
07:40 Oct 24, 2002 Jheijmans deleted "Channel 5/UK"
06:54 Oct 24, 2002 Brion VIBBER deleted "Simon peters"
04:07 Oct 24, 2002 Brion VIBBER deleted "Waring's problem"
03:08 Oct 24, 2002 Brion VIBBER deleted "Propaganda/Slogans"
00:02 Oct 24, 2002 Lee Daniel Crocker deleted "Fred Olsen"
00:00 Oct 24, 2002 Lee Daniel Crocker deleted "James Rosenquist"
23:22 Oct 23, 2002 Lee Daniel Crocker deleted "Minoan civilization"
22:26 Oct 23, 2002 Brion VIBBER deleted "Logging file system"
21:08 Oct 23, 2002 Brion VIBBER deleted "Bloomingberg, ohio"
20:44 Oct 23, 2002 Brion VIBBER deleted "Wikipedia:VANDALISMS IN PROGRESS"
20:34 Oct 23, 2002 JeLuF deleted "Gonville Hall, Cambridge"
20:33 Oct 23, 2002 Maveric149 deleted "Spelling"
20:33 Oct 23, 2002 JeLuF deleted "Morton's Fork"
20:32 Oct 23, 2002 JeLuF deleted "User:0"
20:29 Oct 23, 2002 Ed Poor deleted "The weather in London"
20:21 Oct 23, 2002 JeLuF deleted "Wikipedia:Sucks"
20:20 Oct 23, 2002 Ed Poor deleted "Wikipedia:Sucks"
18:27 Oct 23, 2002 Maveric149 deleted "Pyramid of Djoser"
17:43 Oct 23, 2002 Stephen Gilbert deleted "Compound microscope"
17:23 Oct 23, 2002 Stephen Gilbert deleted "Tillibody"
17:22 Oct 23, 2002 Stephen Gilbert deleted "Tagmemics"
09:59 Oct 23, 2002 Andre Engels deleted "John Fahey"
08:10 Oct 23, 2002 Jheijmans deleted "Pet Sounds"
08:10 Oct 23, 2002 Jheijmans deleted "Vince Clarke"
08:10 Oct 23, 2002 Jheijmans deleted "Charles Augustin de Coulumb"
08:09 Oct 23, 2002 Jheijmans deleted "Chuck Norris"
01:23 Oct 23, 2002 Brion VIBBER deleted "Beltway Sniper"
01:13 Oct 23, 2002 Koyaanis Qatsi deleted "Delete"
01:13 Oct 23, 2002 Koyaanis Qatsi deleted "Dqwe"
01:12 Oct 23, 2002 Koyaanis Qatsi deleted "Delete3432432"
01:12 Oct 23, 2002 Koyaanis Qatsi deleted "Delete123"
00:52 Oct 23, 2002 Karen Johnson deleted "Cock"
00:50 Oct 23, 2002 Karen Johnson deleted "Hillel Slovak"
00:49 Oct 23, 2002 Karen Johnson deleted "Surf Punks"
00:48 Oct 23, 2002 Karen Johnson deleted "Bass rap"
00:47 Oct 23, 2002 Karen Johnson deleted "Sir Andrew Ramsay"
00:45 Oct 23, 2002 Karen Johnson deleted "Sali Berisha"
00:42 Oct 23, 2002 Karen Johnson deleted "Petronius"
00:07 Oct 23, 2002 Andre Engels deleted "Spiral galaxy"
00:06 Oct 23, 2002 Andre Engels deleted "Cervidae"
00:05 Oct 23, 2002 Andre Engels deleted "Swiss Market"
00:03 Oct 23, 2002 Andre Engels deleted "William Rushton"
19:47 Oct 22, 2002 Tarquin deleted "Lalalalalala"
19:26 Oct 22, 2002 Andre Engels deleted "Red River (of the South)"
18:17 Oct 22, 2002 Isis deleted "Image:Janegrey.jpg"
13:14 Oct 22, 2002 Isis deleted "Matrix(Mathematics)"
08:38 Oct 22, 2002 PierreAbbat deleted "Grauspitze"
08:07 Oct 22, 2002 Jheijmans deleted "James Richard Cross"
08:06 Oct 22, 2002 Jheijmans deleted "Governor-General's Award for Creative Non-Fiction"
08:06 Oct 22, 2002 Jheijmans deleted "2196"
08:06 Oct 22, 2002 Jheijmans deleted "Hegemon"
08:06 Oct 22, 2002 Jheijmans deleted "Knuths up-arrow notation"
08:05 Oct 22, 2002 Jheijmans deleted "Sparks, Nevada"
08:04 Oct 22, 2002 Jheijmans deleted "Talk:OMW"
08:03 Oct 22, 2002 Jheijmans deleted "OMW"
05:39 Oct 22, 2002 Maveric149 deleted "Dispatcher"
05:07 Oct 22, 2002 Maveric149 deleted "Munich"
04:47 Oct 22, 2002 Brion VIBBER deleted "Talk:Christopher Columbus"
04:42 Oct 22, 2002 Brion VIBBER deleted "Christopher Columbus"
03:25 Oct 22, 2002 Karen Johnson deleted "Gerdy The Dinosaur"
00:16 Oct 22, 2002 PierreAbbat deleted "Hab Theory"
00:04 Oct 22, 2002 PierreAbbat deleted "Drez"
20:51 Oct 21, 2002 Tarquin deleted "Chronicle of a Death Foretold"
18:18 Oct 21, 2002 Jheijmans deleted "Talk:List of famous people who had sex with animals"
18:18 Oct 21, 2002 Jheijmans deleted "Talk:Benjamin Netanyahu On Terrorism"
18:17 Oct 21, 2002 Jheijmans deleted "Talk:Viral meme"
18:14 Oct 21, 2002 Jheijmans deleted "39/Smooth"
18:14 Oct 21, 2002 Jheijmans deleted "Kerplunk"
18:14 Oct 21, 2002 Jheijmans deleted "Alice Cooper"
18:14 Oct 21, 2002 Jheijmans deleted "PLATO game Spasim"
18:13 Oct 21, 2002 Jheijmans deleted "Hermann Koehl"
18:13 Oct 21, 2002 Jheijmans deleted "Hawkwind/Quark, Strangeness and Charm"
18:11 Oct 21, 2002 Jheijmans deleted "Alexander Girard"
18:09 Oct 21, 2002 Jheijmans deleted "George Nelson"
18:09 Oct 21, 2002 Jheijmans deleted "Ray Ozzie"
18:09 Oct 21, 2002 Jheijmans deleted "Herman Miller"
18:09 Oct 21, 2002 Jheijmans deleted "Gilbert Rohde"
18:09 Oct 21, 2002 Jheijmans deleted "Charles and Ray Eames"
18:09 Oct 21, 2002 Jheijmans deleted "Isamu Noguchi"
18:08 Oct 21, 2002 Jheijmans deleted "Gary Barwin"
18:07 Oct 21, 2002 Jheijmans deleted "El Elote"
18:06 Oct 21, 2002 Jheijmans deleted "Slaughterhouse Five"
18:06 Oct 21, 2002 Jheijmans deleted "IHTFP"
18:02 Oct 21, 2002 Jheijmans deleted "Anthony M. Buzzelli"
18:02 Oct 21, 2002 Jheijmans deleted "The weather in London"
18:00 Oct 21, 2002 Jheijmans deleted "East of Eden"
17:02 Oct 21, 2002 Jheijmans deleted "Bergen, Netherlands"
16:11 Oct 21, 2002 Maveric149 deleted "Munich"
13:06 Oct 21, 2002 Karen Johnson deleted "Motorola 68012"
12:03 Oct 21, 2002 Jheijmans deleted "Frederic Rzewski"
12:02 Oct 21, 2002 Jheijmans deleted "Platonic dialogues"
12:02 Oct 21, 2002 Jheijmans deleted "Larry Brown"
11:58 Oct 21, 2002 PierreAbbat deleted "KWOC"
07:02 Oct 21, 2002 Maveric149 deleted "Hybrid monolithic kernel"
07:02 Oct 21, 2002 Maveric149 deleted "Bus mastering"
05:36 Oct 21, 2002 Maveric149 deleted "Tungsten/Temp"
04:40 Oct 21, 2002 Maveric149 deleted "Middle German"
04:36 Oct 21, 2002 Maveric149 deleted "Dave Farrel"
02:30 Oct 21, 2002 Brion VIBBER deleted "Xu language"
02:22 Oct 21, 2002 Maveric149 deleted "Talk:Omagh bombing"
22:16 Oct 20, 2002 Jheijmans deleted "Hygroscopic"
22:16 Oct 20, 2002 Jheijmans deleted "Andrew Hartzell"
22:15 Oct 20, 2002 Jheijmans deleted "Rodney Moore"
22:15 Oct 20, 2002 Jheijmans deleted "Oyster"
22:14 Oct 20, 2002 Jheijmans deleted "Turbulence"
22:14 Oct 20, 2002 Jheijmans deleted "Langj�kull"
22:14 Oct 20, 2002 Jheijmans deleted "Hofsj�kull"
22:13 Oct 20, 2002 Jheijmans deleted "Vatnaj�kull"
22:13 Oct 20, 2002 Jheijmans deleted "Absurd"
22:13 Oct 20, 2002 Jheijmans deleted "Auguste Comte"
22:13 Oct 20, 2002 Jheijmans deleted "King Bowser Koopa"
22:13 Oct 20, 2002 Jheijmans deleted "Transylvanian Saxon"
22:12 Oct 20, 2002 Jheijmans deleted "Mercury-in-glass thermometer"
22:12 Oct 20, 2002 Jheijmans deleted "Top-down design"
22:11 Oct 20, 2002 Jheijmans deleted "Kid"
22:10 Oct 20, 2002 Jheijmans deleted "Nikolay Nikolaevich Semenov"
14:35 Oct 20, 2002 Tarquin deleted "Spatial tense"
13:13 Oct 20, 2002 PierreAbbat deleted "Habib Bourguiba"
13:12 Oct 20, 2002 PierreAbbat deleted "Talk:Laura Welch Bush"
13:10 Oct 20, 2002 PierreAbbat deleted "Adelbert von Chamisso"
13:10 Oct 20, 2002 PierreAbbat deleted "Derg"
07:42 Oct 20, 2002 Maveric149 deleted "Fritz Perls"
04:32 Oct 20, 2002 Maveric149 deleted "Tantalum/Temp"
02:32 Oct 20, 2002 The Epopt deleted "List of articles not about philosophy"
02:30 Oct 20, 2002 The Epopt deleted "Category experiment"
20:49 Oct 19, 2002 Jheijmans deleted "Carlow"
20:49 Oct 19, 2002 Jheijmans deleted "Jos� Ferrer"
20:49 Oct 19, 2002 Jheijmans deleted "Coal/History"
20:49 Oct 19, 2002 Jheijmans deleted "Turkmenistan/Human rights issues"
20:48 Oct 19, 2002 Jheijmans deleted "MeaningfulNess"
20:48 Oct 19, 2002 Jheijmans deleted "Shepherds Bush"
20:46 Oct 19, 2002 Jheijmans deleted "Italian Communist Party"
20:46 Oct 19, 2002 Jheijmans deleted "Fundamental dimensions/Comments"
20:46 Oct 19, 2002 Jheijmans deleted "Monaghan"
20:46 Oct 19, 2002 Jheijmans deleted "The Hanged Man"
20:46 Oct 19, 2002 Jheijmans deleted "Go proverb"
20:45 Oct 19, 2002 Jheijmans deleted "Mike Dill/My ideas on socital change and terrorism"
20:44 Oct 19, 2002 Jheijmans deleted "Cavan"
20:44 Oct 19, 2002 Jheijmans deleted "McMahon Act"
20:43 Oct 19, 2002 Jheijmans deleted "Writ of Certiorari"
20:43 Oct 19, 2002 Jheijmans deleted "Sanguozhi"
20:42 Oct 19, 2002 Jheijmans deleted "NAGPRA"
20:42 Oct 19, 2002 Jheijmans deleted "Ozarks"
20:42 Oct 19, 2002 Jheijmans deleted "James Barrie"
20:41 Oct 19, 2002 Jheijmans deleted "Fuller Seminary"
20:41 Oct 19, 2002 Jheijmans deleted "Erichtheus"
20:41 Oct 19, 2002 Jheijmans deleted "Human rights abuses"
20:40 Oct 19, 2002 Jheijmans deleted "C-47 Dakota"
20:39 Oct 19, 2002 Jheijmans deleted "C-47 Gooney Bird"
20:11 Oct 19, 2002 Jheijmans deleted "NormanWerner"
20:08 Oct 19, 2002 Jheijmans deleted "Propaganda/Slogans"
20:07 Oct 19, 2002 Jheijmans deleted "Reel-to-Reel"
20:01 Oct 19, 2002 Jheijmans deleted "Microdot"
20:00 Oct 19, 2002 Jheijmans deleted "CPM-86"
20:00 Oct 19, 2002 Jheijmans deleted "Talk:Millinery"
20:00 Oct 19, 2002 Jheijmans deleted "Millinery"
20:00 Oct 19, 2002 Jheijmans deleted "2205 BC"
19:59 Oct 19, 2002 Jheijmans deleted "Mikrophunk"
19:59 Oct 19, 2002 Jheijmans deleted "Gundobad"
19:59 Oct 19, 2002 Jheijmans deleted "Best-first search"
19:58 Oct 19, 2002 Jheijmans deleted "Talk:Philip III of Spain"
19:58 Oct 19, 2002 Jheijmans deleted "Philip III of Spain"
19:58 Oct 19, 2002 Jheijmans deleted "Ferdinand I, Holy Roman Emperor"
19:55 Oct 19, 2002 Jheijmans deleted "Jun Fan"
18:01 Oct 19, 2002 Maveric149 deleted "Siemens Nixdorf Informationssysteme AG"
17:38 Oct 19, 2002 Maveric149 deleted "Liaotung Peninsula"
16:29 Oct 19, 2002 PierreAbbat deleted "Image:Test.phtml"
16:25 Oct 19, 2002 PierreAbbat deleted "Image:Test.php"
16:17 Oct 19, 2002 PierreAbbat deleted "Image:PrattProfile1edit.txt"
16:15 Oct 19, 2002 PierreAbbat deleted "Image:PrattProfile1.txt"
13:35 Oct 19, 2002 Koyaanis Qatsi deleted "Image:Djmangoo-themelody.ogg"
13:34 Oct 19, 2002 Koyaanis Qatsi deleted "Image:SevenDayPrattProfile1.gif"
13:33 Oct 19, 2002 Koyaanis Qatsi deleted "Image:SevenDayPrattProfile2.gif"
13:33 Oct 19, 2002 Koyaanis Qatsi deleted "Image:SevenDayPrattProfile2.gif"
13:32 Oct 19, 2002 Koyaanis Qatsi deleted "Image:PrattProfile1.txt"
13:32 Oct 19, 2002 Koyaanis Qatsi deleted "Image:PrattProfile1edit.txt"
09:52 Oct 19, 2002 Karen Johnson deleted "Bobby Bonds"
09:49 Oct 19, 2002 Karen Johnson deleted "Euramerica"
09:48 Oct 19, 2002 Karen Johnson deleted "Hermeneutic"
09:13 Oct 19, 2002 Karen Johnson deleted "Microsoft SQL server"
08:54 Oct 19, 2002 Karen Johnson deleted "Maynard James Keenan"
08:27 Oct 19, 2002 Karen Johnson deleted "Macuxi"
08:25 Oct 19, 2002 Karen Johnson deleted "Padborg"
04:48 Oct 19, 2002 Koyaanis Qatsi deleted "Two Women"
04:46 Oct 19, 2002 Koyaanis Qatsi deleted "A page that will never be written unless some jerk writes it"
01:34 Oct 19, 2002 Maveric149 deleted "Hernan Cortes"
01:19 Oct 19, 2002 PierreAbbat deleted "Parse tree"
23:30 Oct 18, 2002 PierreAbbat deleted "Newbie"
22:19 Oct 18, 2002 Maveric149 deleted "Canadian Alliance"
22:05 Oct 18, 2002 Maveric149 deleted "Thirteen Years' War"
21:18 Oct 18, 2002 Ed Poor deleted "Univeristy of California, Berkeley"
20:46 Oct 18, 2002 Lee Daniel Crocker deleted "Max Stirner"
18:52 Oct 18, 2002 Maveric149 deleted "Hawker Hunter"
11:34 Oct 18, 2002 Karen Johnson deleted "Lindau"
11:33 Oct 18, 2002 Karen Johnson deleted "Ruma"
11:32 Oct 18, 2002 Karen Johnson deleted "KDD"
11:31 Oct 18, 2002 Karen Johnson deleted "Law of conservation of matter"
10:38 Oct 18, 2002 PierreAbbat deleted "Asymmetric cryptography"
03:43 Oct 18, 2002 PierreAbbat deleted "Battle of Eylau"
00:03 Oct 18, 2002 PierreAbbat deleted "My"
23:03 Oct 17, 2002 Andre Engels deleted "Chilomonas"
22:30 Oct 17, 2002 PierreAbbat deleted "2208"
22:28 Oct 17, 2002 PierreAbbat deleted "Water wheel"
22:25 Oct 17, 2002 PierreAbbat deleted "ASF"
18:23 Oct 17, 2002 Maveric149 deleted "Goedel's completeness theorem"
13:51 Oct 17, 2002 Andre Engels deleted "Soon"
12:34 Oct 17, 2002 Andre Engels deleted "First Crusade"
12:00 Oct 17, 2002 Stephen Gilbert deleted "Wardian case"
01:51 Oct 17, 2002 PierreAbbat deleted "Christian Dior"
01:49 Oct 17, 2002 PierreAbbat deleted "Hybrid monolithic kernel"
01:15 Oct 17, 2002 Stephen Gilbert deleted "Turn-based game"
01:15 Oct 17, 2002 Stephen Gilbert deleted "Alain Mimoun"
22:09 Oct 16, 2002 PierreAbbat deleted "Screen Actors Guild"
22:08 Oct 16, 2002 PierreAbbat deleted "Middle-Earth Roleplaying System"
19:46 Oct 16, 2002 Tarquin deleted "Conspicuous consumption"
15:53 Oct 16, 2002 Andre Engels deleted "Talk:Scientific mythology"
15:53 Oct 16, 2002 Andre Engels deleted "Talk:Scientific mythology"
15:52 Oct 16, 2002 Andre Engels deleted "Scientific mythology"
15:48 Oct 16, 2002 Tarquin deleted "Blue Nile"
15:33 Oct 16, 2002 Andre Engels deleted "Talk:Hayden Christiansen"
15:27 Oct 16, 2002 Andre Engels deleted "Talk:Millions of worthless articles"
15:22 Oct 16, 2002 Andre Engels deleted "Talk:Friends United Meeting"
15:10 Oct 16, 2002 Andre Engels deleted "Talk:Q Codes"
11:53 Oct 16, 2002 PierreAbbat deleted "Thivai"
11:40 Oct 16, 2002 PierreAbbat deleted "Travels With Charley"
11:38 Oct 16, 2002 PierreAbbat deleted "Problem domain"
11:22 Oct 16, 2002 Andre Engels deleted "John Forbes Nash"
10:43 Oct 16, 2002 Jheijmans deleted "The Oresteia"
10:43 Oct 16, 2002 Jheijmans deleted "Business management"
10:42 Oct 16, 2002 Jheijmans deleted "Ray Gillen"
09:35 Oct 16, 2002 Andre Engels deleted "Image:German flag 1815.png"
09:33 Oct 16, 2002 Andre Engels deleted "Xenon/Temp"
08:09 Oct 16, 2002 Sjc deleted "Amatol"
06:47 Oct 16, 2002 Jheijmans deleted "Akron, Ohio"
06:47 Oct 16, 2002 Jheijmans deleted "Penal code"
06:47 Oct 16, 2002 Jheijmans deleted "Superstring"
06:47 Oct 16, 2002 Jheijmans deleted "Unified field theory"
06:46 Oct 16, 2002 Jheijmans deleted "Other LZ compression methods"
06:46 Oct 16, 2002 Jheijmans deleted "Bizarro"
06:46 Oct 16, 2002 Jheijmans deleted "Ear piercing"
05:59 Oct 16, 2002 Sjc deleted "Flying Wedge"
05:57 Oct 16, 2002 Sjc deleted "AEW"
02:47 Oct 16, 2002 PierreAbbat deleted "Homeric Hymns"
02:46 Oct 16, 2002 PierreAbbat deleted "Pisistratos"
01:19 Oct 16, 2002 Maveric149 deleted "Sweet Home Alabama (movie)"
01:05 Oct 16, 2002 Maveric149 deleted "USS Valley"
00:14 Oct 16, 2002 PierreAbbat deleted "Jay Warren"
00:12 Oct 16, 2002 PierreAbbat deleted "Mustique"
22:56 Oct 15, 2002 Maveric149 deleted "Egg cell"
22:53 Oct 15, 2002 Jheijmans deleted "Ciutat Vella"
22:49 Oct 15, 2002 Jheijmans deleted "Like nailing jelly to a tree"
22:48 Oct 15, 2002 Jheijmans deleted "Like kicking dead whales down the beach"
22:16 Oct 15, 2002 Jheijmans deleted "James Batcheller Sumner"
22:16 Oct 15, 2002 Jheijmans deleted "MC Det"
22:06 Oct 15, 2002 Jheijmans deleted "New England boiled dinner"
22:06 Oct 15, 2002 Jheijmans deleted "1208 BC"
22:06 Oct 15, 2002 Jheijmans deleted "WikiProject Biology"
22:05 Oct 15, 2002 Jheijmans deleted "Abelian variety"
22:05 Oct 15, 2002 Jheijmans deleted "Cassette"
22:04 Oct 15, 2002 Jheijmans deleted "DBA"
22:04 Oct 15, 2002 Jheijmans deleted "Application layer"
22:04 Oct 15, 2002 Jheijmans deleted "Vacation"
22:04 Oct 15, 2002 Jheijmans deleted "Caledonia"
22:03 Oct 15, 2002 Jheijmans deleted "Lamp"
22:03 Oct 15, 2002 Jheijmans deleted "Talk:Status"
22:03 Oct 15, 2002 Jheijmans deleted "Status"
22:02 Oct 15, 2002 Jheijmans deleted "Mathematics Magazine"
22:02 Oct 15, 2002 Jheijmans deleted "Rangefinder cameras"
22:02 Oct 15, 2002 Jheijmans deleted "Copy protection"
22:02 Oct 15, 2002 Jheijmans deleted "Other LZ compression methods"
22:01 Oct 15, 2002 Maveric149 deleted "Laccolith"
19:37 Oct 15, 2002 Brion VIBBER deleted "Microsoft Windows 2.0"
18:59 Oct 15, 2002 Stephen Gilbert deleted "Talk:Put"
18:58 Oct 15, 2002 Stephen Gilbert deleted "SPIHT"
18:57 Oct 15, 2002 Stephen Gilbert deleted "Put"
18:57 Oct 15, 2002 Stephen Gilbert deleted "Marcel Petiot"
18:57 Oct 15, 2002 Stephen Gilbert deleted "WSDL"
18:28 Oct 15, 2002 Magnus Manske deleted "L�ndervorwahlen/nachNummern"
18:26 Oct 15, 2002 Tarquin deleted "User:ZxAnPhOrIaN/StateReportSites"
18:00 Oct 15, 2002 Scipius deleted "Jean Renoir"
14:48 Oct 15, 2002 Tarquin deleted "Cretinous"
14:44 Oct 15, 2002 Tarquin deleted "Brain-damaged"
13:10 Oct 15, 2002 Tarquin deleted "Calculus/chain rule"
12:29 Oct 15, 2002 Tarquin deleted "Prime number/Talk"
10:16 Oct 15, 2002 Jheijmans deleted "Slovenia/Temp"
06:42 Oct 15, 2002 Jheijmans deleted "USS Lake"
06:41 Oct 15, 2002 Jheijmans deleted "USS Philippine"
06:41 Oct 15, 2002 Jheijmans deleted "USS Bunker"
06:40 Oct 15, 2002 Jheijmans deleted "USS San"
06:40 Oct 15, 2002 Jheijmans deleted "USS Leyte"
06:40 Oct 15, 2002 Jheijmans deleted "USS Coral"
06:40 Oct 15, 2002 Jheijmans deleted "USS Belleau"
06:09 Oct 15, 2002 Karen Johnson deleted "USS Franklin"
02:02 Oct 15, 2002 Karen Johnson deleted "Brown Deer, Wisconsin"
02:01 Oct 15, 2002 Karen Johnson deleted "4004 BC"
02:01 Oct 15, 2002 Karen Johnson deleted "Jacques Cossette-Trudel"
02:00 Oct 15, 2002 Karen Johnson deleted "University of Wisconsin, Stout"
01:59 Oct 15, 2002 Karen Johnson deleted "Jangyn Bridge"
01:59 Oct 15, 2002 Karen Johnson deleted "Poissy"
01:59 Oct 15, 2002 Karen Johnson deleted "Talk:Poissy"
01:58 Oct 15, 2002 Karen Johnson deleted "Xerox 1108"
01:57 Oct 15, 2002 Karen Johnson deleted "Data vector"
01:55 Oct 15, 2002 Karen Johnson deleted "Danville, Kentucky"
22:15 Oct 14, 2002 Jheijmans deleted "Bosnian language"
21:57 Oct 14, 2002 Scipius deleted "Electric battery"
21:44 Oct 14, 2002 Scipius deleted "Talk:Germany/Temp"
21:43 Oct 14, 2002 Scipius deleted "Germany/Temp"
21:13 Oct 14, 2002 Jheijmans deleted "Erasmus"
21:00 Oct 14, 2002 PierreAbbat deleted "General Federation of Jewish Labour"
16:35 Oct 14, 2002 Jheijmans deleted "Liudolf of Swabia"
16:33 Oct 14, 2002 Jheijmans deleted "Quay"
16:30 Oct 14, 2002 Jheijmans deleted "Emma Bunton"
16:30 Oct 14, 2002 Jheijmans deleted "Pavel Chekov"
12:26 Oct 14, 2002 Brion VIBBER deleted "TWA 847 hijacking"
11:58 Oct 14, 2002 PierreAbbat deleted "U.S. presidential election, 2012"
09:31 Oct 14, 2002 Maveric149 deleted "Route inspection problem"
08:55 Oct 14, 2002 Maveric149 deleted "Popper"
07:56 Oct 14, 2002 Magnus Manske deleted "Henk Rogers"
07:49 Oct 14, 2002 Jheijmans deleted "Ani Yuntikwalaski"
07:48 Oct 14, 2002 Jheijmans deleted "Zulch, Evan"
07:48 Oct 14, 2002 Jheijmans deleted "Evan Zulch"
07:46 Oct 14, 2002 Jheijmans deleted "Sandra Dempsey"
07:45 Oct 14, 2002 Jheijmans deleted "Cassiodorus"
07:45 Oct 14, 2002 Jheijmans deleted "Daniel Vettori"
07:44 Oct 14, 2002 Jheijmans deleted "El Lissitzky"
07:44 Oct 14, 2002 Jheijmans deleted "Text to speech"
07:44 Oct 14, 2002 Jheijmans deleted "Natural language generation"
07:44 Oct 14, 2002 Jheijmans deleted "Program transformation"
06:27 Oct 14, 2002 Sjc deleted "Maclyn McCarty"
04:24 Oct 14, 2002 Maveric149 deleted "2109"
03:37 Oct 14, 2002 Maveric149 deleted "Phosphorus/Temp"
01:03 Oct 14, 2002 Maveric149 deleted "Law of Octaves"
00:56 Oct 14, 2002 Maveric149 deleted "Andr� Malraux"
22:53 Oct 13, 2002 PierreAbbat deleted "Rockefeller Institute"
22:52 Oct 13, 2002 PierreAbbat deleted "Acrostic puzzle"
22:50 Oct 13, 2002 Tarquin deleted "Raymon Smullyan"
21:19 Oct 13, 2002 Bryan Derksen deleted "Great Red Spot"
21:14 Oct 13, 2002 Maveric149 deleted "Superscript"
21:13 Oct 13, 2002 Maveric149 deleted "Natural order"
21:08 Oct 13, 2002 Andre Engels deleted "Talk:Confused Deputy Problem"
21:01 Oct 13, 2002 Andre Engels deleted "Talk:Common Earth Language"
20:58 Oct 13, 2002 Andre Engels deleted "Xerox Document Company"
20:58 Oct 13, 2002 Andre Engels deleted "Nuclear pile"
17:31 Oct 13, 2002 PierreAbbat deleted "Cheddite"
12:25 Oct 13, 2002 PierreAbbat deleted "Supercharger"
10:32 Oct 13, 2002 Sjc deleted "Holt, England"
10:24 Oct 13, 2002 Jheijmans deleted "Loaded terminology"
09:49 Oct 13, 2002 Scipius deleted "Quercus robur- Ongoing projects & To Do list..."
07:46 Oct 13, 2002 Sjc deleted "October 12 2002 car bomb, Kuta, Bali"
07:04 Oct 13, 2002 Maveric149 deleted "Latin phrases"
02:14 Oct 13, 2002 Maveric149 deleted "American Christian Zionists"
23:34 Oct 12, 2002 Scipius deleted "Curly Howard"
22:20 Oct 12, 2002 Jheijmans deleted "Steamboat"
21:41 Oct 12, 2002 Magnus Manske deleted "Redirect test page A"
21:41 Oct 12, 2002 Magnus Manske deleted "Redirect test page C"
21:41 Oct 12, 2002 Magnus Manske deleted "Redirect test page B"
21:12 Oct 12, 2002 Tarquin deleted "Talk:The simpsons/dr. nick riviera"
20:37 Oct 12, 2002 Jheijmans deleted "Kent Keith"
20:35 Oct 12, 2002 Jheijmans deleted "FrameMaker"
16:35 Oct 12, 2002 Andre Engels deleted "Robert Guiscard"
15:59 Oct 12, 2002 Andre Engels deleted "SoHo, New York City, New York"
15:59 Oct 12, 2002 Andre Engels deleted "Murray Hill, New York City, New York"
15:58 Oct 12, 2002 Andre Engels deleted "Harlem, New York City, New York"
15:58 Oct 12, 2002 Andre Engels deleted "Greenwich Village, New York City, New York"
15:32 Oct 12, 2002 PierreAbbat deleted "List of famous people who had sex with animals"
14:36 Oct 12, 2002 Tarquin deleted "ZxAnPhOrIaN/StateReportSites"
13:09 Oct 12, 2002 PierreAbbat deleted "Charles Cunningham Boycott"
12:10 Oct 12, 2002 Andre Engels deleted "Internet gaming"
12:09 Oct 12, 2002 Andre Engels deleted "Joe Rock"
12:08 Oct 12, 2002 Andre Engels deleted "Herman Brusselmans"
12:08 Oct 12, 2002 Andre Engels deleted "Queen Anne's War"
11:49 Oct 12, 2002 Karen Johnson deleted "Europrix"
03:36 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (city names)"
03:35 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (ships)"
03:34 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (movies)"
03:34 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (names and titles)"
03:33 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (precision)"
03:32 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (common names)"
03:32 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (anglicization)"
03:31 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (pluralization)"
03:30 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (capitalization)"
03:28 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (acronyms)"
02:25 Oct 12, 2002 Karen Johnson deleted "VMWare"
02:24 Oct 12, 2002 Karen Johnson deleted "List of famous people who had sex with animals"
00:27 Oct 12, 2002 Tarquin deleted "HfTupper"
23:47 Oct 11, 2002 Andre Engels deleted "List of collective nouns by collective terms"
23:44 Oct 11, 2002 Andre Engels deleted "Talk:ColdWar"
23:03 Oct 11, 2002 Andre Engels deleted "Talk:Chinese characteristics"
22:58 Oct 11, 2002 Andre Engels deleted "Talk:Queen (Chess)"
22:49 Oct 11, 2002 Andre Engels deleted "Talk:Ǭ��解"
22:38 Oct 11, 2002 Andre Engels deleted "Talk:Candy blunt"
22:33 Oct 11, 2002 Andre Engels deleted "Talk:Business and Industry basic topics"
22:28 Oct 11, 2002 Andre Engels deleted "Talk:Bubi"
22:26 Oct 11, 2002 Scipius deleted "Mossel Bay"
22:25 Oct 11, 2002 Scipius deleted "Georges Pompidou"
22:24 Oct 11, 2002 Scipius deleted "Carboxyl group"
22:20 Oct 11, 2002 Andre Engels deleted "Talk:Bridge game"
22:17 Oct 11, 2002 Andre Engels deleted "Talk:Boure"
22:16 Oct 11, 2002 Andre Engels deleted "Talk:Boris the crazy Russian"
22:08 Oct 11, 2002 Andre Engels deleted "Talk:Blue-green money"
22:00 Oct 11, 2002 Andre Engels deleted "Talk:Bilbo"
21:49 Oct 11, 2002 Andre Engels deleted "Talk:Belief in God spectrum"
21:41 Oct 11, 2002 Andre Engels deleted "Talk:Battle of TannenburgBattle of Grunwald"
21:34 Oct 11, 2002 Andre Engels deleted "Talk:Baptism of the dead"
21:33 Oct 11, 2002 Andre Engels deleted "Talk:Bantu languages"
21:30 Oct 11, 2002 Andre Engels deleted "Talk:Baker Natalie Bachrach"
18:29 Oct 11, 2002 Ed Poor deleted "Talk:List of famous people who have pierced their private parts"
17:50 Oct 11, 2002 Jheijmans deleted "Victoria, Seychelles"
11:54 Oct 11, 2002 Andre Engels deleted "Nika revolt"
11:50 Oct 11, 2002 PierreAbbat deleted "Togidubnus"
11:15 Oct 11, 2002 Karen Johnson deleted "Antonella Brugnola"
07:21 Oct 11, 2002 Jheijmans deleted "Siobhan Fahey"
07:21 Oct 11, 2002 Jheijmans deleted "Augusta of Saxe-Gotha"
07:20 Oct 11, 2002 Jheijmans deleted "Governor-General's Award for Creative Non-Fiction"
07:19 Oct 11, 2002 Jheijmans deleted "War of the Grand Alliance"
07:19 Oct 11, 2002 Jheijmans deleted "William Pitt, the Younger"
06:50 Oct 11, 2002 Jheijmans deleted "Partido dos Trabalhadores"
06:49 Oct 11, 2002 Jheijmans deleted "Amazonia"
06:49 Oct 11, 2002 Jheijmans deleted "Fred Olsen"
06:48 Oct 11, 2002 Jheijmans deleted "Talk:Autodynamics"
06:48 Oct 11, 2002 Jheijmans deleted "Autodynamics"
06:47 Oct 11, 2002 Jheijmans deleted "DNA computer"
06:46 Oct 11, 2002 Jheijmans deleted "Matthew Lancelot Ryan"
05:34 Oct 11, 2002 Maveric149 deleted "Eternity"
01:49 Oct 11, 2002 PierreAbbat deleted "Toba"
01:44 Oct 11, 2002 PierreAbbat deleted "Blah"
01:00 Oct 11, 2002 Maveric149 deleted "Macintosh raincoat"
20:49 Oct 10, 2002 Scipius deleted "Cafe wall illusion"
20:15 Oct 10, 2002 Tarquin deleted "Line segment"
20:15 Oct 10, 2002 Tarquin deleted "Pembrokeshire"
20:15 Oct 10, 2002 Tarquin deleted "Channel coding"
18:07 Oct 10, 2002 Scipius deleted "Image:Uk flag largeupsidedown.png"
18:04 Oct 10, 2002 Scipius deleted "Image:Waveflag.gif"
16:11 Oct 10, 2002 Scipius deleted "Nixon"
12:19 Oct 10, 2002 Jheijmans deleted "Shooting at the 1936 Summer Olympics"
12:08 Oct 10, 2002 Karen Johnson deleted "Shar"
09:28 Oct 10, 2002 Jheijmans deleted "Palette"
09:27 Oct 10, 2002 Jheijmans deleted "Executive department"
07:00 Oct 10, 2002 Maveric149 deleted "Helium/Temp"
06:50 Oct 10, 2002 Robert Merkel deleted "Drexel Shaft"
06:49 Oct 10, 2002 Robert Merkel deleted "Talk:Drexel Shaft"
06:46 Oct 10, 2002 Jheijmans deleted "Robert Moses"
06:46 Oct 10, 2002 Jheijmans deleted "Correspondence course"
06:44 Oct 10, 2002 Jheijmans deleted "Discordance Axis"
06:44 Oct 10, 2002 Jheijmans deleted "Frederick, Lord North"
06:44 Oct 10, 2002 Jheijmans deleted "Social Development"
06:43 Oct 10, 2002 Jheijmans deleted "Obfuscated PostScript Contest"
06:43 Oct 10, 2002 Jheijmans deleted "Gungan"
01:19 Oct 10, 2002 PierreAbbat deleted "Pinworm"
00:26 Oct 10, 2002 Andre Engels deleted "Zacharias Janssen"
21:43 Oct 9, 2002 PierreAbbat deleted "Motnitroat"
20:47 Oct 9, 2002 PierreAbbat deleted "Contract bridge palying technique"
19:54 Oct 9, 2002 Andre Engels deleted "Talk:50 kroner note"
19:54 Oct 9, 2002 Andre Engels deleted "Talk:200 kroner note"
19:48 Oct 9, 2002 Magnus Manske deleted "Topory"
19:42 Oct 9, 2002 Andre Engels deleted "Talk:ATI"
19:28 Oct 9, 2002 Ed Poor deleted "Time base"
19:27 Oct 9, 2002 Ed Poor deleted "Staff system"
19:27 Oct 9, 2002 Andre Engels deleted "Talk:Anthocyanins"
19:26 Oct 9, 2002 Andre Engels deleted "Talk:Anomy"
19:25 Oct 9, 2002 Andre Engels deleted "Talk:Angel/far-fetched belief"
19:24 Oct 9, 2002 Andre Engels deleted "Talk:Ancient civilization"
19:22 Oct 9, 2002 Andre Engels deleted "Talk:Anarchy Online"
19:20 Oct 9, 2002 Andre Engels deleted "Talk:American Union of Men"
19:18 Oct 9, 2002 Andre Engels deleted "Talk:Amead"
19:15 Oct 9, 2002 Andre Engels deleted "Talk:A.L.I.C.E"
18:57 Oct 9, 2002 Andre Engels deleted "Talk:Adek336"
18:50 Oct 9, 2002 Andre Engels deleted "Talk:2002 State of the Union Address"
18:49 Oct 9, 2002 Andre Engels deleted "Talk:72 virgins"
18:43 Oct 9, 2002 Andre Engels deleted "Talk:23nd century"
18:39 Oct 9, 2002 Andre Engels deleted "Talk:Antiwikipedic"
18:33 Oct 9, 2002 Andre Engels deleted "Painting techniques"
18:32 Oct 9, 2002 Andre Engels deleted "Anna Moffo"
17:49 Oct 9, 2002 Scipius deleted "Afar language"
17:44 Oct 9, 2002 Scipius deleted "Bayer Company"
17:39 Oct 9, 2002 Scipius deleted "Ypres"
17:24 Oct 9, 2002 PierreAbbat deleted "Heian Period"
17:21 Oct 9, 2002 PierreAbbat deleted "Zhu"
17:21 Oct 9, 2002 PierreAbbat deleted "Zhu"
08:09 Oct 9, 2002 Andre Engels deleted "Cleisthenes"
06:34 Oct 9, 2002 Jheijmans deleted "Mossel Bay"
06:34 Oct 9, 2002 Jheijmans deleted "Clerks"
06:34 Oct 9, 2002 Jheijmans deleted "World War II/The Blitz"
06:33 Oct 9, 2002 Jheijmans deleted "Bridge of Sighs"
06:32 Oct 9, 2002 Maveric149 deleted "Syntax analysis"
06:07 Oct 9, 2002 Maveric149 deleted "Neon/Temp"
00:44 Oct 9, 2002 Maveric149 deleted "Waxhaw, South Carolina"
22:31 Oct 8, 2002 Lee Daniel Crocker deleted "Natural catastrophe"
22:30 Oct 8, 2002 Lee Daniel Crocker deleted "Ignatius Donnelly"
21:37 Oct 8, 2002 Jheijmans deleted "Khamis Mushait"
21:35 Oct 8, 2002 Jheijmans deleted "Kleene algebra"
21:35 Oct 8, 2002 Jheijmans deleted "Extranet"
21:35 Oct 8, 2002 Jheijmans deleted "Young Turks"
21:35 Oct 8, 2002 Jheijmans deleted "Motorola 68008"
21:34 Oct 8, 2002 Jheijmans deleted "Milwaukee Deep"
21:34 Oct 8, 2002 Jheijmans deleted "Polish-Lithuanian Commonwealth"
19:17 Oct 8, 2002 Tarquin deleted "Clifford E. Berry"
17:30 Oct 8, 2002 PierreAbbat deleted "Cockermouth"
15:45 Oct 8, 2002 Tarquin deleted "Hiawatha"
15:44 Oct 8, 2002 Tarquin deleted "Mazurka"
10:46 Oct 8, 2002 Jheijmans deleted "Provisional Government"
10:37 Oct 8, 2002 Andre Engels deleted "Internet humor/Two Cows Talk"
10:36 Oct 8, 2002 Jheijmans deleted "Romania/Temp"
10:34 Oct 8, 2002 Andre Engels deleted "Beloit College"
10:31 Oct 8, 2002 Andre Engels deleted "New York City, New York/Murray Hill"
10:30 Oct 8, 2002 Andre Engels deleted "New York City, New York/Harlem"
08:56 Oct 8, 2002 WojPob deleted "Motorola Coldfire"
08:33 Oct 8, 2002 Jheijmans deleted "List of Biblical names starting with W"
08:32 Oct 8, 2002 Jheijmans deleted "List of Biblical names starting with X"
08:31 Oct 8, 2002 Jheijmans deleted "Sympathomimetic"
08:28 Oct 8, 2002 Jheijmans deleted "Talk:OsmosisTwo"
08:28 Oct 8, 2002 Jheijmans deleted "OsmosisTwo"
08:27 Oct 8, 2002 Jheijmans deleted "Protea"
08:26 Oct 8, 2002 Jheijmans deleted "Teunis de Wit"
08:26 Oct 8, 2002 Jheijmans deleted "Talk:John T. Thompson"
08:26 Oct 8, 2002 Jheijmans deleted "John T. Thompson"
08:25 Oct 8, 2002 Jheijmans deleted "Talk:Kaspar Schlick"
08:25 Oct 8, 2002 Jheijmans deleted "Kaspar Schlick"
07:45 Oct 8, 2002 Maveric149 deleted "Manned space mission"
06:53 Oct 8, 2002 Jheijmans deleted "Lost Jerusalem"
06:52 Oct 8, 2002 Jheijmans deleted "Eldridge"
06:52 Oct 8, 2002 Jheijmans deleted "Neo Jerusalem"
06:51 Oct 8, 2002 Jheijmans deleted "Aveh"
06:40 Oct 8, 2002 Maveric149 deleted "Rubber tire"
06:40 Oct 8, 2002 WojPob deleted "APHMEC"
06:34 Oct 8, 2002 Jheijmans deleted "Teddy Flack"
06:33 Oct 8, 2002 Jheijmans deleted "Non-zero-sum games"
06:32 Oct 8, 2002 Jheijmans deleted "Description"
06:25 Oct 8, 2002 Jheijmans deleted "Meet in the middle"
06:25 Oct 8, 2002 Jheijmans deleted "Miniscule"
06:24 Oct 8, 2002 Jheijmans deleted "Joseph-Marie Jacquard"
06:23 Oct 8, 2002 Jheijmans deleted "William Bradford"
06:23 Oct 8, 2002 Jheijmans deleted "Hokkien"
06:23 Oct 8, 2002 Jheijmans deleted "Fad"
06:22 Oct 8, 2002 Jheijmans deleted "Dahab, Egypt"
05:45 Oct 8, 2002 Maveric149 deleted "Argon/Temp"
03:18 Oct 8, 2002 Maveric149 deleted "Kristin Otto"
02:18 Oct 8, 2002 Brion VIBBER deleted "Hadrian's Wall"
01:20 Oct 8, 2002 Maveric149 deleted "Jian"
01:18 Oct 8, 2002 Maveric149 deleted "Cape Town"
00:10 Oct 8, 2002 Andre Engels deleted "Berger Roy Al"
00:08 Oct 8, 2002 Andre Engels deleted "Anarcosocial-communism"
00:08 Oct 8, 2002 Andre Engels deleted "Loyda Morales"
00:07 Oct 8, 2002 Andre Engels deleted "Bonneville Apartments"
23:56 Oct 7, 2002 Maveric149 deleted "London College of Fashion"
23:44 Oct 7, 2002 Maveric149 deleted "Mustard agent"
23:42 Oct 7, 2002 Maveric149 deleted "Pacific loon"
23:08 Oct 7, 2002 Maveric149 deleted "Party congress of the CPSU"
23:03 Oct 7, 2002 Maveric149 deleted "Law of Canada"
22:14 Oct 7, 2002 Lee Daniel Crocker deleted "WINE"
21:34 Oct 7, 2002 Tarquin deleted "Madame Grey"
17:51 Oct 7, 2002 Jheijmans deleted "Luxembourg/Temp"
15:04 Oct 7, 2002 PierreAbbat deleted "S�Archittu"
14:22 Oct 7, 2002 Tarquin deleted "Dungeons & Dragons (temp)"
14:22 Oct 7, 2002 Tarquin deleted "Dungeons & Dragons"
14:10 Oct 7, 2002 Jheijmans deleted "Nagoya"
13:38 Oct 7, 2002 PierreAbbat deleted "S�Archittu"
13:27 Oct 7, 2002 Jheijmans deleted "Talk:North Brabant/Temp"
13:27 Oct 7, 2002 Jheijmans deleted "North Brabant/Temp"
13:24 Oct 7, 2002 WojPob deleted "Defence Intelligence Agency"
11:06 Oct 7, 2002 Tarquin deleted "Mole (espianoge)"
10:33 Oct 7, 2002 Andre Engels deleted "Image:Pistols.jpg"
10:32 Oct 7, 2002 Andre Engels deleted "Image:Sulfanilamide.png"
10:29 Oct 7, 2002 Andre Engels deleted "Image:Pistols.jpg"
10:27 Oct 7, 2002 Andre Engels deleted "Image:Sulfanilamide.png"
07:57 Oct 7, 2002 Isis deleted "Beverly K Effinger"
07:54 Oct 7, 2002 Jheijmans deleted "Guido Carli"
06:59 Oct 7, 2002 Jheijmans deleted "Djibouti/Temp"
06:57 Oct 7, 2002 Maveric149 deleted "Zebulun Kurth-Nelson"
06:53 Oct 7, 2002 Maveric149 deleted "Clark Prensoil Potter"
06:52 Oct 7, 2002 Maveric149 deleted "Spoken game"
06:32 Oct 7, 2002 Jheijmans deleted "Airglow"
06:32 Oct 7, 2002 Jheijmans deleted "Interjection"
06:31 Oct 7, 2002 Jheijmans deleted "Babington Conspiracy"
06:31 Oct 7, 2002 Jheijmans deleted "Executive department"
06:30 Oct 7, 2002 Jheijmans deleted "Second Athenian Empire"
06:30 Oct 7, 2002 Jheijmans deleted "Stirrer"
05:53 Oct 7, 2002 WojPob deleted "Chinese grammar"
04:26 Oct 7, 2002 Maveric149 deleted "Sexual perversion"
01:50 Oct 7, 2002 Andre Engels deleted "Walter Benjamin"
01:48 Oct 7, 2002 Andre Engels deleted "Canandaigua, New York"
01:45 Oct 7, 2002 Andre Engels deleted "One-party system"
01:34 Oct 7, 2002 Stephen Gilbert deleted "Logos and slogans"
23:43 Oct 6, 2002 Maveric149 deleted "Rod Carew"
23:40 Oct 6, 2002 Maveric149 deleted "Central heating"
23:36 Oct 6, 2002 Maveric149 deleted "Internet service provider"
21:50 Oct 6, 2002 Tarquin deleted "National Trust (England, Wales and Northern Ireland) properties"
21:45 Oct 6, 2002 Tarquin deleted "Parse tree"
19:56 Oct 6, 2002 Jheijmans deleted "Ellobiopsids"
19:56 Oct 6, 2002 Jheijmans deleted "Spoken game"
19:55 Oct 6, 2002 Jheijmans deleted "Olga Pyleva"
19:55 Oct 6, 2002 Jheijmans deleted "New Ipswich, New Hampshire"
19:55 Oct 6, 2002 Jheijmans deleted "A00 Sokolsky Opening 1.e4 e5"
11:08 Oct 6, 2002 Maveric149 deleted "Krypton/Temp"
10:32 Oct 6, 2002 WojPob deleted "Tezpur, Assam"
10:30 Oct 6, 2002 WojPob deleted "Stephen King/Dolans Cadillac"
07:36 Oct 6, 2002 Koyaanis Qatsi deleted "Not Black supremacy"
07:17 Oct 6, 2002 Jheijmans deleted "Mythology of demons"
07:16 Oct 6, 2002 Jheijmans deleted "Babington Conspiracy"
07:15 Oct 6, 2002 Jheijmans deleted "Diplomonads"
07:15 Oct 6, 2002 Jheijmans deleted "Moose Jaw"
07:15 Oct 6, 2002 Jheijmans deleted "1 E21 m"
07:14 Oct 6, 2002 Jheijmans deleted "Florianus"
21:37 Oct 5, 2002 Brion VIBBER deleted "Junk page that is being deleted to confirm bug is fixed"
23:15 Oct 5, 2002 WojPob deleted "Mass Production"
09:51 Oct 5, 2002 Maveric149 deleted "Helsinki"
14:13 Oct 5, 2002 The Epopt deleted "C-46 Commando"
14:13 Oct 5, 2002 The Epopt deleted "C-47 Skytrain"
14:29 Oct 5, 2002 Scipius deleted "Das Kapital"
06:19 Oct 5, 2002 Maveric149 deleted "Human"
06:17 Oct 5, 2002 Maveric149 deleted "Humans"
13:10 Oct 5, 2002 Scipius deleted "Testingwhetherthereisalimittothelengthsofpagenamesddlskdlaskdnvlknancsklnasnfdoaiwnrpiwnrpqnrpqwnrpiqnneifniqnfiqwnipqwnfiqwnfiqwnfpiwqnfpinfipqnfipqwnfipnqwfpniwnfqpmmqcpomowmcmcopqwmpowcmopqwmcoqwpmcowpqmcopqmwcopwmcopmqcwopmcopqmwocpmwocmopcwqmopwqmcop"
19:26 Oct 4, 2002 Maveric149 deleted "Wikipedia:Tom Tommorrow"
21:44 Oct 4, 2002 Tarquin deleted "Coppicing/pollarding"
22:58 Oct 4, 2002 Ed Poor deleted "SPIHT"
20:35 Oct 4, 2002 Jheijmans deleted "Horace de Saussure"
20:35 Oct 4, 2002 Jheijmans deleted "Cisternae"
20:35 Oct 4, 2002 Jheijmans deleted "Israeli Security Zone"
20:35 Oct 4, 2002 Jheijmans deleted "United Nations Partition Plan"
17:39 Oct 4, 2002 Koyaanis Qatsi deleted ".phtml"
18:43 Oct 4, 2002 Ed Poor deleted "State sponsors of terrorism"
17:43 Oct 4, 2002 Jheijmans deleted "Ghent"
12:55 Oct 4, 2002 Andre Engels deleted "Pearson Hashing"
12:37 Oct 4, 2002 Andre Engels deleted "Duck duck goose"
12:05 Oct 4, 2002 Jheijmans deleted "Exchange rate"
11:10 Oct 4, 2002 Andre Engels deleted "Red Sonja"
11:07 Oct 4, 2002 Andre Engels deleted "Johan Helsingius"
11:01 Oct 4, 2002 Andre Engels deleted "I didn't change anything!"
08:54 Oct 4, 2002 Jheijmans deleted "Emotional punditry"
08:54 Oct 4, 2002 Jheijmans deleted "Environmental wacko"
08:51 Oct 4, 2002 Jheijmans deleted "StarEdit"
08:49 Oct 4, 2002 Jheijmans deleted "Thames/pollution"
08:45 Oct 4, 2002 Jheijmans deleted "Ekumen"
08:44 Oct 4, 2002 Jheijmans deleted "The Dispossessed"
08:34 Oct 4, 2002 Jheijmans deleted "Vitamin E familial isolated, deficiency of"
08:34 Oct 4, 2002 Jheijmans deleted "Clara Thrupp"
08:33 Oct 4, 2002 Jheijmans deleted "Eric Hoffman"
08:32 Oct 4, 2002 Jheijmans deleted "Talk:Belief"
08:32 Oct 4, 2002 Jheijmans deleted "Belief"
08:31 Oct 4, 2002 Jheijmans deleted "Carol"
08:29 Oct 4, 2002 Jheijmans deleted "Dinant"
08:29 Oct 4, 2002 Jheijmans deleted "Stevertigo"
08:29 Oct 4, 2002 Jheijmans deleted "Secret key"
08:29 Oct 4, 2002 Jheijmans deleted "Dorchester, England"
08:29 Oct 4, 2002 Jheijmans deleted "G3"
08:28 Oct 4, 2002 Jheijmans deleted "Philosophical Investigations/family resemblance"
08:28 Oct 4, 2002 Jheijmans deleted "Aswan High Dam"
08:28 Oct 4, 2002 Jheijmans deleted "U.s. presidental election, 1948"
08:27 Oct 4, 2002 Jheijmans deleted "Sunset"
08:27 Oct 4, 2002 Jheijmans deleted "TWA 847 hijacking"
06:22 Oct 4, 2002 Brion VIBBER deleted "Green economics"
08:18 Oct 4, 2002 WojPob deleted "Howdoudeleteapage"
23:58 Oct 3, 2002 Brion VIBBER deleted "Green Economism"
19:15 Oct 3, 2002 Jheijmans deleted "Existentialism/Old"
18:27 Oct 3, 2002 Jheijmans deleted "Toe"
18:26 Oct 3, 2002 Jheijmans deleted "Electrostatic field"
18:25 Oct 3, 2002 Jheijmans deleted "Henri D�sir� Landru"
18:24 Oct 3, 2002 Jheijmans deleted "Marcel Petiot"
10:27 Oct 3, 2002 Brion VIBBER deleted "Santa Cruz Operation"
12:16 Oct 3, 2002 Jheijmans deleted "Adzuki bean"
11:48 Oct 3, 2002 Jheijmans deleted "Obfuscating software"
10:28 Oct 3, 2002 Tarquin deleted "Hazaed (game)"
11:19 Oct 3, 2002 Jheijmans deleted "Brazil's anthem, entitled Hino Nacional Brasileiro"
09:10 Oct 3, 2002 Jheijmans deleted "San Marino/Temp"
09:01 Oct 3, 2002 Jheijmans deleted "Seth Howard"
09:01 Oct 3, 2002 Jheijmans deleted "Weak entity"
09:00 Oct 3, 2002 Jheijmans deleted "Philip III of Spain"
08:58 Oct 3, 2002 Jheijmans deleted "Charles Spurgeon"
08:57 Oct 3, 2002 Jheijmans deleted "Hans Eijsackers"
08:57 Oct 3, 2002 Jheijmans deleted "Morals or Ethics"
08:56 Oct 3, 2002 Jheijmans deleted "Curved Air"
08:56 Oct 3, 2002 Jheijmans deleted "Bad Religion"
08:55 Oct 3, 2002 Jheijmans deleted "Pcl"
08:55 Oct 3, 2002 Jheijmans deleted "Meersburg"
08:54 Oct 3, 2002 Jheijmans deleted "Mainau Island"
08:54 Oct 3, 2002 Jheijmans deleted "Hugh Richardson"
08:53 Oct 3, 2002 Jheijmans deleted "Andra� Crouch"
08:53 Oct 3, 2002 Jheijmans deleted "Battle of Lexington and Concord"
08:52 Oct 3, 2002 Jheijmans deleted "Flight AF 8969 Alger-Paris hijacked"
08:50 Oct 3, 2002 Jheijmans deleted "University of Kiel"
08:50 Oct 3, 2002 Jheijmans deleted "Yang di-Pertuan Agong"
23:48 Oct 2, 2002 Maveric149 deleted "Predicate calculus"
23:46 Oct 2, 2002 Maveric149 deleted "Radon/Temp"
19:47 Oct 2, 2002 PierreAbbat deleted "Battle of Lutzen"
19:45 Oct 2, 2002 PierreAbbat deleted "Talk:Electronic filter"
19:15 Oct 2, 2002 PierreAbbat deleted "Blue Gene"
01:43 Oct 3, 2002 Andre Engels deleted "Roman emperor"
22:00 Oct 2, 2002 Brion VIBBER deleted "Peasants' Revolt"
23:29 Oct 2, 2002 Andre Engels deleted "Port Royal"
21:47 Oct 2, 2002 Tarquin deleted "Antiwikipedic"
21:40 Oct 2, 2002 Tarquin deleted "Antiwikipedic"
22:43 Oct 2, 2002 -- April deleted "Antiwikipedic"
22:27 Oct 2, 2002 -- April deleted "Antiwikipedic"
20:28 Oct 2, 2002 -- April deleted "Antiwikipedic"
20:24 Oct 2, 2002 -- April deleted "Antiwikipedic"
20:09 Oct 2, 2002 -- April deleted "Wikipedic"
20:08 Oct 2, 2002 -- April deleted "Wikipedia: Antiwikipedic"
20:07 Oct 2, 2002 -- April deleted "Antiwikipedic"
19:52 Oct 2, 2002 -- April deleted "Antiwikipedic"
15:54 Oct 2, 2002 Koyaanis Qatsi deleted "Antiwikipedic"
15:43 Oct 2, 2002 Koyaanis Qatsi deleted "AntiWikipedic"
00:42 Oct 3, 2002 Stephen Gilbert deleted "Stephen Gilbert"
00:32 Oct 3, 2002 Stephen Gilbert deleted "STG"
17:01 Oct 2, 2002 Andre Engels deleted "Laurasia"
16:52 Oct 2, 2002 Andre Engels deleted "CTSS"
16:17 Oct 2, 2002 Jheijmans deleted "Maurice"
14:01 Oct 2, 2002 Andre Engels deleted "Riptor's articles"
09:20 Oct 2, 2002 Jheijmans deleted "Transaction processing"
09:08 Oct 2, 2002 Jheijmans deleted "In Vitro Fertilisation/Todo"
08:50 Oct 2, 2002 Andre Engels deleted "Global warming/Todo"
08:45 Oct 2, 2002 Jheijmans deleted "Fuller Theological Seminary"
08:23 Oct 2, 2002 Jheijmans deleted "Pseudorandom"
08:22 Oct 2, 2002 Jheijmans deleted "Vaux-le-Vicomte"
08:21 Oct 2, 2002 Jheijmans deleted "Ann Theresa de Keersmaker"
23:21 Oct 1, 2002 Maveric149 deleted "Barney Rubble"
23:00 Oct 1, 2002 Maveric149 deleted "Ned Ludd"
23:00 Oct 1, 2002 Maveric149 deleted "Self-starvation"
22:57 Oct 1, 2002 Maveric149 deleted "Middle High German"
22:54 Oct 1, 2002 Maveric149 deleted "Aeolic"
22:53 Oct 1, 2002 Maveric149 deleted "Oliver Ellsworth"
22:52 Oct 1, 2002 Maveric149 deleted "HMAS Darwin"
22:52 Oct 1, 2002 Maveric149 deleted "Chemical burn"
22:51 Oct 1, 2002 Maveric149 deleted "Fluoride"
18:57 Oct 1, 2002 Andre Engels deleted "Stem cell/Todo"
01:06 Oct 2, 2002 Stephen Gilbert deleted "Wikipedia talk:What Google Likes"
09:57 Oct 1, 2002 Tarquin deleted "Guiness Book of World Records"
10:39 Oct 1, 2002 Jheijmans deleted "Peat bog"
09:50 Oct 1, 2002 Jheijmans deleted "Ashtanga Yoga"